Property Summary

NCBI Gene PubMed Count 365
Grant Count 1,000
R01 Count 405
Funding $232,706,740.5
PubMed Score 18478.16
PubTator Score 239.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 0.000

Synonym

Accession P07288 C9JXH3 G3V0H4 G3XAE3 Q15096 Q16272 Q86TG8 Q8IXI4 PSA
Symbols APS
PSA
hK3
KLK2A1

Gene

PDB

1PFA   2PSA   2ZCH   2ZCK   2ZCL   3QUM  

Gene RIF (310)

PMID Text
27065039 Results show that urinary PSA glycoforms are able to discriminate prostate cancer from protastatic hyperplasia with higher sensitivity and specificity for prostate cancer than those of the serum PSA marker.
26928323 No significant differences in in KLK3 expression were found between radical prostatectomy-prostate cancer and radical prostatectomy-benign samples.
26914149 BMI should be taken into consideration when referring men to a prostate biopsy based on serum PSA-levels.
26723876 Ad5/35E1aPSESE4 is effective in marking PSA/PSMA-positive prostate cancer cells in patient blood to improve the efficacy of utilizing CTCs as a biomarker.
26706772 PSCA TT genotype is associated with a more than a threefold increase in the prevalence and the extent of gastric mucosal intestinal mucosa compared to C allele carriers among H. pylori-infected Bhutanese.
26458958 We observed an association of higher Ki-67 expression with Gleason sum National Comprehensive Cancer Network risk (P=0.013) and PSA recurrence
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
26153794 PSA expression is highly homogenous in primary prostate cancer.
26039628 detection of prostate cancer and according to PSA screening to distinguish men with prostate cancer from men with benign prostatic hyperplasia.
26033153 Prostate magnetic resonance imaging before prostate biopsy appeared to offer similar diagnostic accuracy compared with routine transrectal ultrasound-guided random biopsy in the diagnosis of suspected prostate cancer based on elevated prostate specific antigen values.
More...

AA Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNK      1 - 70
SVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMD     71 - 140
LPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCS    141 - 210
GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP                       211 - 261
//

Text Mined References (367)

PMID Year Title
27065039 2016 Analysis of Urinary Prostate-Specific Antigen Glycoforms in Samples of Prostate Cancer and Benign Prostate Hyperplasia.
26928323 2016 Global expression of AMACR transcripts predicts risk for prostate cancer - a systematic comparison of AMACR protein and mRNA expression in cancerous and noncancerous prostate.
26914149 2016 Body mass index in relation to serum prostate-specific antigen levels and prostate cancer risk.
26723876 2016 Ad5/35E1aPSESE4: A novel approach to marking circulating prostate tumor cells with a replication competent adenovirus controlled by PSA/PSMA transcription regulatory elements.
26706772 2016 Prostate stem cell antigen gene TT genotype and development of intestinal metaplasia in Helicobacter pylori infection.
26458958 2016 Evaluation of an epithelial plasticity biomarker panel in men with localized prostate cancer.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26153794 2015 PSMA expression is highly homogenous in primary prostate cancer.
26039628 2015 Combination of Autoantibody Signature with PSA Level Enables a Highly Accurate Blood-Based Differentiation of Prostate Cancer Patients from Patients with Benign Prostatic Hyperplasia.
26033153 2016 Prebiopsy Multiparametric Magnetic Resonance Imaging for Prostate Cancer Diagnosis in Biopsy-naive Men with Suspected Prostate Cancer Based on Elevated Prostate-specific Antigen Values: Results from a Randomized Prospective Blinded Controlled Trial.
More...