Property Summary

NCBI Gene PubMed Count 100
PubMed Score 1042.49
PubTator Score 305.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Craniosynostosis 74 0.0 4.0
Osteogenesis imperfecta 34 0.0 4.0

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 1.183 4.3e-05
astrocytoma 1.800 8.9e-04
Astrocytoma, Pilocytic 1.700 1.7e-03
atypical teratoid / rhabdoid tumor 2.500 6.5e-06
Breast cancer 3.500 2.6e-02
COPD -1.100 1.5e-02
diabetes mellitus -1.200 1.4e-02
ependymoma 1.600 2.7e-02
glioblastoma 1.900 2.7e-04
group 4 medulloblastoma 2.200 1.2e-03
intraductal papillary-mucinous adenoma (... -2.600 2.0e-03
intraductal papillary-mucinous carcinoma... -2.300 5.6e-03
intraductal papillary-mucinous neoplasm ... -3.300 7.6e-03
invasive ductal carcinoma 1.400 5.0e-03
lung adenocarcinoma 2.369 1.9e-13
lung cancer 1.100 4.1e-04
malignant mesothelioma -1.400 1.2e-06
medulloblastoma, large-cell 3.500 4.9e-06
Multiple myeloma 1.394 8.9e-04
non-small cell lung cancer 1.853 4.1e-13
oligodendroglioma 1.700 1.1e-02
osteosarcoma 3.053 1.5e-05
ovarian cancer -2.200 8.3e-13
pancreatic cancer -1.100 3.9e-03
pancreatic ductal adenocarcinoma liver m... -1.241 1.1e-02
pediatric high grade glioma 2.400 2.3e-04
pituitary cancer -1.300 2.0e-02
primitive neuroectodermal tumor 1.300 1.8e-03
psoriasis 1.100 5.2e-03

Protein-protein Interaction (2)

Gene RIF (35)

AA Sequence

MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKL      1 - 70
KAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTL     71 - 140
PDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFD    141 - 210
EGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAE    211 - 280
SFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGK    281 - 350
IKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI    351 - 420
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEA    421 - 490
EEPDMEEDDDQKAVKDEL                                                        491 - 508
//

Text Mined References (104)

PMID Year Title