Property Summary

NCBI Gene PubMed Count 202
PubMed Score 2143.90
PubTator Score 167.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma 1.800 6.3e-04
astrocytoma 1.600 3.3e-11
Astrocytoma, Pilocytic 3.000 3.4e-11
atypical teratoid / rhabdoid tumor 1.500 9.8e-05
axial spondyloarthropathy 1.100 4.0e-02
Breast cancer -2.700 1.5e-17
breast carcinoma -1.900 1.5e-39
chronic rhinosinusitis -2.618 8.5e-03
cystic fibrosis and chronic rhinosinusit... -2.376 1.1e-02
dermatomyositis 1.800 1.8e-03
Duchenne muscular dystrophy 1.511 4.5e-09
ependymoma 1.400 1.3e-05
gastric cancer 1.300 1.5e-02
glioblastoma 2.200 1.5e-08
interstitial cystitis 1.100 5.7e-05
invasive ductal carcinoma -1.194 2.9e-04
lung adenocarcinoma -1.300 1.8e-11
lung cancer -2.400 2.6e-06
lung carcinoma -2.600 3.4e-32
mucosa-associated lymphoid tissue lympho... 2.147 4.7e-03
non-small cell lung cancer -1.561 1.5e-16
oligodendroglioma 1.400 1.1e-09
ovarian cancer -4.500 1.3e-09
pancreatic cancer 1.700 2.2e-03
pancreatic carcinoma 1.700 2.2e-03
pancreatic ductal adenocarcinoma liver m... -2.712 8.2e-03
subependymal giant cell astrocytoma 3.244 2.0e-02
tuberculosis 1.100 2.4e-03

Protein-protein Interaction (1)

Gene RIF (160)

AA Sequence

MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEARE      1 - 70
VFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKAS     71 - 140
FTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPS    141 - 210
ICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQK    211 - 280
SCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWL    281 - 350
LIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL    351 - 420
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGI    421 - 490
AQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIY    491 - 560
RIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSAT    561 - 630
PVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS                            631 - 676
//

Text Mined References (227)

PMID Year Title