Property Summary

NCBI Gene PubMed Count 188
Grant Count 286
R01 Count 91
Funding $122,711,152.84
PubMed Score 1853.88
PubTator Score 167.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07225 A8KAC9 D3DN28 Q15518 Q7Z715 Q9UCZ8
Symbols PSA
PROS
PS21
PS22
PS23
PS24
PS25
THPH5
THPH6

Gene

PDB

1Z6C  

Gene RIF (146)

PMID Text
26354831 Elevated levels of circulating microparticles can play a role in carriers of mild and severe inherited thrombophilia resulting from protein S deficiency.
26186226 The ELISA system using the PS K196E mutation-specific antibody is a useful tool for the rapid identification of PS K196E carriers, who are at a higher risk for venous thromboembolism.
25997409 A PROS1 c.1486_1490delGATTA mutation on exon 12. appeared to be the primary cause of thrombosis in the family of the present study.
25879167 Women with low levels of plasma PS activity and free PS during early pregnancy might have increased risks of pregnancy-induced hypertension, or pre-eclampsia.
25868595 analysis of compound heterozygote protein S deficiency in two Japanese patients [case reports]
25716664 analysis of the amino acid residues in the laminin G domains of protein S involved in tissue factor pathway inhibitor interaction
25399514 Protein S exacerbates acute alcoholic hepatitis by inhibiting apoptosis of activated natural killer T cells.
24992033 Identical large duplication mutation of PROS1 was detected in 3 unrelated patients with thrombophilia from hereditary protein S deficiency.
24740810 Data indicate that the protein S sex hormone-binding globulin (SHBG)-like domain was important for binding and enhancement of tissue factor pathway inhibitor (TFPI).
24331211 Anti-human protein S antibody induces tissue factor expression through a direct interaction with PFKP and ERK1/2 activation in coronary artery endothelial cells.
More...

AA Sequence

MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEARE      1 - 70
VFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKAS     71 - 140
FTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPS    141 - 210
ICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQK    211 - 280
SCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWL    281 - 350
LIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL    351 - 420
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGI    421 - 490
AQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIY    491 - 560
RIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSAT    561 - 630
PVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS                            631 - 676
//

Text Mined References (212)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26354831 2016 Circulating microparticles and the risk of thrombosis in inherited deficiencies of antithrombin, protein C and protein S.
26186226 2015 ELISA-Based Detection System for Protein S K196E Mutation, a Genetic Risk Factor for Venous Thromboembolism.
25997409 2015 Hereditary protein S deficiency leads to ischemic stroke.
25879167 2015 Low levels of plasma protein S, protein C and coagulation factor XII during early pregnancy and adverse pregnancy outcome.
25868595 2015 Late onset thrombosis in two Japanese patients with compound heterozygote protein S deficiency.
25716664 2015 Amino acid residues in the laminin G domains of protein S involved in tissue factor pathway inhibitor interaction.
25399514 2015 Protein S exacerbates alcoholic hepatitis by stimulating liver natural killer T cells.
24992033 2014 The genomic architecture of the PROS1 gene underlying large tandem duplication mutation that causes thrombophilia from hereditary protein S deficiency.
24740810 2014 TFPI cofactor function of protein S: essential role of the protein S SHBG-like domain.
More...