Property Summary

NCBI Gene PubMed Count 24
PubMed Score 67.75
PubTator Score 27.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGV      1 - 70
PMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKI     71 - 140
KAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLA    141 - 210
ILGGAKVADKIQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRI    211 - 280
TFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAK    281 - 350
GTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM       351 - 417
//

Text Mined References (28)

PMID Year Title