Property Summary

NCBI Gene PubMed Count 24
Grant Count 19
R01 Count 6
Funding $3,123,829.57
PubMed Score 68.01
PubTator Score 27.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (2)

PMID Text
24000349 Data from studies in transgenic mice suggest that Pgk2 core promoter elements are required to direct demethylation of DNA and reconfiguration of nucleosomes in testis during sexual maturation and spermatogenesis.
18976975 Knockdown of phosphoglycerate kinase 2 (PGK2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGV      1 - 70
PMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKI     71 - 140
KAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLA    141 - 210
ILGGAKVADKIQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRI    211 - 280
TFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAK    281 - 350
GTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM       351 - 417
//

Text Mined References (28)

PMID Year Title
26677959 2016 Characteristics of testis-specific phosphoglycerate kinase 2 and its association with human sperm quality.
24000349 2013 Sequence-specific promoter elements regulate temporal-specific changes in chromatin required for testis-specific activation of the Pgk2 gene.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20459611 2010 Frequent and recent retrotransposition of orthologous genes plays a role in the evolution of sperm glycolytic enzymes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19333399 2009 Spermatogenesis associated retrogenes are expressed in the human ovary and ovarian cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...