Property Summary

NCBI Gene PubMed Count 251
Grant Count 358
R01 Count 223
Funding $48,463,602.62
PubMed Score 1927.44
PubTator Score 1211.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Disseminated intravascular coagulation 32 6.529 3.3
Atherosclerosis 275 4.679 2.3
Protein C deficiency 19 4.258 2.1
Kidney disease 396 4.139 2.1
Cancer 2,346 4.105 2.1
Hypertension 287 4.093 2.0
Coronary artery disease 240 4.086 2.0
Thrombotic thrombocytopenic purpura 14 4.05 2.0
Cerebrovascular disease 231 4.011 2.0
Lupus erythematosus 80 3.788 1.9
Vasculitis 64 3.776 1.9
Thrombocytopenia 105 3.657 1.8
Heart disease 279 3.626 1.8
diabetes mellitus 1,663 3.569 1.8
Anemia 252 3.515 1.8
Purpura fulminans 7 3.471 1.7
Lung disease 132 3.458 1.7
Connective tissue disease 59 3.386 1.7
Antiphospholipid syndrome 18 3.267 1.6
Protein S deficiency 5 3.203 1.6
Dengue hemorrhagic fever 4 3.14 1.6
Peripheral vascular disease 90 3.105 1.6
Liver disease 219 3.098 1.5
Acute Promyelocytic Leukemia 31
Atypical Hemolytic Uremic Syndrome 9
Breast cancer 3,094
HEMOLYTIC UREMIC SYNDROME, ATYPICAL, SUS... 1 
Myocardial Infarction 126
Pulmonary Embolism 45
Purpura, Thrombotic Thrombocytopenic 4
Respiratory Distress Syndrome, Adult 6
Stomach Neoplasms 282
Thrombophilia 36 4.0
Thrombophilia due to Thrombomodulin Defe... 1 
Thrombosis 42
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
breast carcinoma 1,614
cystic fibrosis 1,665
group 4 medulloblastoma 1,875
hemolytic-uremic syndrome 28 4.0
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
non-small cell lung cancer 2,798
ovarian cancer 8,484
pituitary cancer 1,972
psoriasis 6,685
ulcerative colitis 2,087

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.600 0.005
cystic fibrosis -2.605 0.000
adrenocortical carcinoma -1.356 0.030
non-small cell lung cancer -1.828 0.000
intraductal papillary-mucinous adenoma (... -2.400 0.003
intraductal papillary-mucinous carcinoma... -3.200 0.001
lung cancer -3.700 0.000
breast carcinoma -1.100 0.002
interstitial cystitis 1.300 0.002
lung adenocarcinoma -2.380 0.000
group 4 medulloblastoma -1.200 0.000
aldosterone-producing adenoma -1.161 0.037
Breast cancer -1.200 0.045
lung carcinoma -1.800 0.000
ulcerative colitis 2.900 0.000
ovarian cancer -3.800 0.000
pituitary cancer -2.600 0.000

Synonym

Accession P07204 Q8IV29 Q9UC32 TM
Symbols TM
THRM
AHUS6
BDCA3
CD141
THPH12

Gene

PDB

1DX5   1HLT   3GIS   1ADX   1DQB   1EGT   1FGD   1FGE   1TMR   1ZAQ   2ADX  

Gene RIF (222)

PMID Text
26891741 Decreased thrombomodulin expression in preeclampsia may play a role in placental dysfunction in preeclampsia and is possibly caused by an angiogenic imbalance. Hypertension and obesity are associated with thrombomodulin downregulation.
26888356 evidence of association between the -33G/A polymorphism in the TM gene and the risk of myocardial infarction in Asians; the Ala455Val variant was not associated with atherosclerotic risk [meta-analysis]
26634653 Identified Nur77/Nor1 as novel regulators of thrombomodulin expression and function in vascular endothelial cells.
26468766 A minimal TM fragment consisting of the fourth, fifth, and most of the sixth EGF-like domain (TM456m) that has been prepared has much improved solubility, thrombin binding capacity, and anticoagulant activity versus those of previous TM456 constructs.
26338301 Membrane-bound TM in macrophages plays an essential role in the development of abdominal aortic aneurysms by enhancing proinflammatory mediator elaboration, macrophage recruitment, and oxidative stress.
26246110 the functional relevance of the rs3176123 variation and indicate that higher thrombomodulin expression by individuals with the 2729C allele likely accounts for their decreased risk for acute GVHD development and subsequent mortality.
26226255 The presence of THBD proximal promoter polymorphisms do not explain variations in levels of serum and cell-expressed THBD in premature acute coronary syndrome patients in Bahrain.
26179123 The EGF5, 6 domains of thrombomodulin appear to be the major domains for down-regulating the complement system rather than the lectin-like domain during xenogenic stimuli.
26159646 The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility.
25790110 levels of protein C and soluble thrombomodulin in critically ill patients with acute kidney injury
More...

AA Sequence

MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADV      1 - 70
ISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAV     71 - 140
SAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVG    141 - 210
SSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSC    211 - 280
TASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH    281 - 350
CYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN    351 - 420
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDCDSGKVDGGDS    421 - 490
GSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCAAPSKE    491 - 560
VVLQHVRTERTPQRL                                                           561 - 575
//

Text Mined References (251)

PMID Year Title
27055590 2016 LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.
26891741 2016 Loss of Thrombomodulin in Placental Dysfunction in Preeclampsia.
26888356 2016 Association of Thrombomodulin Gene Polymorphisms with Susceptibility to Atherosclerotic Diseases: A Meta-Analysis.
26634653 2016 Antithrombotic Effects of Nur77 and Nor1 Are Mediated Through Upregulating Thrombomodulin Expression in Endothelial Cells.
26468766 2015 Thrombomodulin Binding Selects the Catalytically Active Form of Thrombin.
26338301 2015 Membrane-Bound Thrombomodulin Regulates Macrophage Inflammation in Abdominal Aortic Aneurysm.
26246110 2015 A donor thrombomodulin gene variation predicts graft-versus-host disease development and mortality after bone marrow transplantation.
26226255 2015 Thrombomodulin gene proximal promoter polymorphisms in premature acute coronary syndrome patients in Bahrain.
26179123 Human thrombomodulin regulates complement activation as well as the coagulation cascade in xeno-immune response.
26159646 2015 Variants in the Atherogenic ALOX5AP, THBD, and KNG1 Genes Potentiate the Risk of Ischemic Stroke via a Genetic Main Effect and Epistatic Interactions in a Chinese Population.
More...