Property Summary

NCBI Gene PubMed Count 307
PubMed Score 886.73
PubTator Score 442.98

Knowledge Summary

Patent

No data available

Expression

Gene RIF (322)

AA Sequence

MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRG      1 - 70
LVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDA     71 - 140
TALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA           141 - 203
//

Text Mined References (311)

PMID Year Title