Property Summary

NCBI Gene PubMed Count 274
Grant Count 198
R01 Count 134
Funding $21,597,417.66
PubMed Score 828.61
PubTator Score 442.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07203 E9PAS1 Q7Z5H1 Q9BW12 GPx-1
Symbols GPXD
GSHPX1

Gene

PANTHER Protein Class (2)

PDB

2F8A  

Gene RIF (290)

PMID Text
27069153 No significant difference was found for NRAMP1 and hGPX1 gene polymorphisms associated with recurrence time.
27067415 SOD2 but not GPx1 activity decreased significantly in the presence of the mutated allele (Val and Leu, respectively).
26990426 In patients with chronic hepatitis C, the GPX1 Pro198Leu polymorphism, alone or combined with the CAT C-262T, was associated with high risk of fibrosis severity and hepatocellular carcinoma (HCC). In addition, GPX1 polymorphism was also associated with advanced stages of HCC.
26829742 MIF -173CC and GPX1 594TT and high-fat diet are the risk factors for ulcerative colitis.
26782341 1,25D3 works as a modifier of NF-kappaB/GPX1/uPA expression, inhibiting cisplatin-resistance and cell invasive ability of salivary adenoid cystic carcinoma cells
26773925 The minor T-allele of rs3448 of GPX1 was associated with kidney complications (incidences of microalbuminuria, renal events and ESRD) in patients with type 1 diabetes.
26685757 GPx1 rs1800668 polymorphism does not play a major role in sensitivity-related illnesses -related oxidative stress development.
26662676 GPX1*Pro198Leu AND GPX3 rs2070593 as genetic risk markers for Italian asthmatic patients
26477504 An increase in both SOD1 and GPx1 activity is involved in the protective effect of sulodexide on ischemic endothelial cells.
26446998 GPX1 polymorphism may be an important factor modifying oxidative stress response in breast cancer subjects.
More...

AA Sequence

MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRG      1 - 70
LVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDA     71 - 140
TALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA           141 - 203
//

Text Mined References (278)

PMID Year Title
27069153 2016 Predictive Value of NRAMP1 and HGPX1 Gene Polymorphism for Maintenance BCG Response in Non-muscle-invasive Bladder Cancer.
27067415 2016 MnSOD and GPx1 polymorphism relationship with coronary heart disease risk and severity.
26990426 2016 Association of Catalase and Glutathione Peroxidase 1 Polymorphisms with Chronic Hepatitis C Outcome.
26829742 2016 [Interaction of MIF gene -173G/C polymorphism and GPX1 gene 594C/T polymorphism with high-fat diet in ulcerative colitis].
26782341 2016 1,25-Dihydroxyvitamin D3 alleviates salivary adenoid cystic carcinoma progression by suppressing GPX1 expression through the NF-?B pathway.
26773925 2016 Glutathione peroxidase-1 gene (GPX1) variants, oxidative stress and risk of kidney complications in people with type 1 diabetes.
26685757 2016 Assessment of glutathione peroxidase-1 polymorphisms, oxidative stress and DNA damage in sensitivity-related illnesses.
26662676 2016 GPX1*Pro198Leu AND GPX3 rs2070593 as genetic risk markers for Italian asthmatic patients.
26477504 2016 Superoxide dismutase 1 and glutathione peroxidase 1 are involved in the protective effect of sulodexide on vascular endothelial cells exposed to oxygen-glucose deprivation.
26446998 2015 Lipid peroxidation and glutathione peroxidase activity relationship in breast cancer depends on functional polymorphism of GPX1.
More...