Property Summary

NCBI Gene PubMed Count 147
Grant Count 149
R01 Count 108
Funding $18,010,511.05
PubMed Score 549.82
PubTator Score 1403.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma -1.600 0.000

Synonym

Accession P07202 P09934 P09935 Q8IUL0 Q8NF94 Q8NF95 Q8NF96 Q8NF97 Q8TCI9 TPO
Symbols MSA
TPX
TDH2A

Gene

TPO

PANTHER Protein Class (2)

Gene RIF (109)

PMID Text
26663066 Data show that thyroperoxidase (TPO) single nucleotide polymorphisms (SNPs) rs4927611 TT and rs732609 CC are genotypes associated with potential risk for the congenital hypothyroidism (CH).
26623656 function and autoantigenicity of TPO
26361424 Lower pretreatment serum CXCL10 levels are associated with thyroid dysfunction. Thyroid dysfunction prevalence increases in female patients and patients who are positive for TPOAb at baseline.
26174974 Two novel inactivating mutations (c.1970T> C and c.2665G> T) in the TPO gene cause congenital hypothyroidism.
26070305 analysis of thyroid peroxidase autoantibody levels in type 1 diabetes in discordant twin pairs
25968604 This is the first description of a TD causing mutation in Tunisia and thus may help to develop a genetic screening protocol for congenital hypothyroidism in the studied region.
25611592 perioperative TPO dynamics are associated with postoperative LD. Postoperative TPO levels were found to be lowest in high-risk patients (HCC patients undergoing major resection) but showed an independent predictive value.
25576858 Molecular cloning and functional studies of wild type and mutant forms harboring missense mutations in TPO gene showed decreased activity in the three mutants, higher Km values and lower reaction efficiencies (Vmax/Km).
25564141 The detection of the novel c.670_672del and c.1186C>T alterations expand the mutation spectrum of TPO associated with thyroid dyshormonogenesis.
25328990 This study confirms the pathogenicity of Y55X mutation in two patients with congenital hypothyroidism and demonstrates that a nonsense mutation in the amino-terminal coding region of the TPO gene could totally abolish the function of the TPO enzyme leading to total iodide organification defect.
More...

AA Sequence

MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSP      1 - 70
AQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPP     71 - 140
KCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTR    141 - 210
HVIQVSNEVVTDDDRYSDLLMAWGQYIDHDIAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARP    211 - 280
AAGTACLPFYRSSAACGTGDQGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLL    281 - 350
RVHARLRDSGRAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA    351 - 420
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAF    421 - 490
RFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIRGLLARPAKLQVQDQLMNEEL    491 - 560
TERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSVADKILDLYKHPD    561 - 630
NIDVWLGGLAENFLPRARTGPLFACLIGKQMKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTG    631 - 700
LTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRH    701 - 770
GYELQGREQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD    771 - 840
SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQAVGTSPQRAA    841 - 910
AQDSEQESAGMEGRDTHRLPRAL                                                   911 - 933
//

Text Mined References (148)

PMID Year Title
26663066 2015 [Association of thyroperoxidase gene polymorphisms with dyshormonogenesis in congenital hypothyroidism].
26623656 2015 Modelling of Thyroid Peroxidase Reveals Insights into Its Enzyme Function and Autoantigenicity.
26361424 2015 Thyroid dysfunction in Chinese hepatitis C patients: Prevalence and correlation with TPOAb and CXCL10.
26174974 2015 Novel genetic variants in the TPO gene cause congenital hypothyroidism.
26070305 2015 Heritability of thyroid peroxidase autoantibody levels in type 1 diabetes: evidence from discordant twin pairs.
25968604 2015 Segregation of S292F TPO gene mutation in three large Tunisian families with thyroid dyshormonogenesis: evidence of a founder effect.
25611592 2015 Deficiency in thrombopoietin induction after liver surgery is associated with postoperative liver dysfunction.
25576858 2015 Kinetic characterization of human thyroperoxidase. Normal and pathological enzyme expression in Baculovirus system: a molecular model of functional expression.
25564141 2015 Prevalence of c.2268dup and detection of two novel alterations, c.670_672del and c.1186C>T, in the TPO gene in a cohort of Malaysian-Chinese with thyroid dyshormonogenesis.
25328990 2015 A truncating TPO mutation (Y55X) in patients with hypothyroidism and total iodide organification defect.
More...