Property Summary

NCBI Gene PubMed Count 37
Grant Count 36
R01 Count 13
Funding $5,697,838.35
PubMed Score 322.70
PubTator Score 124.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
astrocytic glioma -4.500 0.004
posterior fossa group B ependymoma -6.400 0.000
oligodendroglioma -3.600 0.020
glioblastoma -4.400 0.000
group 4 medulloblastoma -6.200 0.000
cystic fibrosis 1.452 0.001
periodontitis -1.300 0.000
atypical teratoid/rhabdoid tumor -4.900 0.000
colon cancer -1.400 0.000
adult high grade glioma -5.400 0.000
pilocytic astrocytoma -5.100 0.000
severe Alzheimer's disease -1.725 0.035
lung carcinoma 1.600 0.000
Pick disease -2.200 0.027
pituitary cancer -1.500 0.042
Down syndrome -1.100 0.038

Gene RIF (19)

PMID Text
24636402 There was a strongly elevated reactivity against neurofilament medium in a subset of schizophrenia patients compared to controls.
24489003 HIV-1 Tat modulates NEFM expression in neuron cells
24489003 HIV-1 Tat modulates NEFM expression in neuron cells
21956116 HIV-1 Tat modulates NEFM expression in neuron cells
21816823 HIV-1 Tat modulates NEFM expression in neuron cells
20624930 direct evidence that NF-M/H are hyperphosphorylated in Alzheimer disease
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20213320 the importance of alpha-internexin and NF-L in regulating the conformations of NF-M and NF-H
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSS      1 - 70
AESSLDFSQSSSLLNGGSGPGGDYKLSRSNEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIQALRQKQ     71 - 140
ASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDI    141 - 210
EEASLVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITVERKDYLKTDISTALKEIRSQLESH    211 - 280
SDQNMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEE    281 - 350
RHNHDLSSYQDTIQQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFAGSIT    351 - 420
GPLYTHRPPITISSKIQKPKVEAPKLKVQHKFVEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKE    421 - 490
AAEEKEEEPEAEEEEVAAKKSPVKATAPEVKEEEGEKEEEEGQEEEEEEDEGAKSDQAEEGGSEKEGSSE    491 - 560
KEEGEQEEGETEAEAEGEEAEAKEEKKVEEKSEEVATKEELVADAKVEKPEKAKSPVPKSPVEEKGKSPV    561 - 630
PKSPVEEKGKSPVPKSPVEEKGKSPVPKSPVEEKGKSPVSKSPVEEKAKSPVPKSPVEEAKSKAEVGKGE    631 - 700
QKEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAESPVKEEAVAEVVTITKSVKVHLEKETKEEGKPLQQ    701 - 770
EKEKEKAGGEGGSEEEGSDKGAKGSRKEDIAVNGEVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPAD    771 - 840
EKKGGDKSEEKVVVTKTVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVK    841 - 910
EVTQSD                                                                    911 - 916
//

Text Mined References (44)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24636402 2014 Elevated levels of autoantibodies targeting the M1 muscarinic acetylcholine receptor and neurofilament medium in sera from subgroups of patients with schizophrenia.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21828286 2011 Direct evidence of phosphorylated neuronal intermediate filament proteins in neurofibrillary tangles (NFTs): phosphoproteomics of Alzheimer's NFTs.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20624930 2010 Quantitative phosphoproteomic analysis of neuronal intermediate filament proteins (NF-M/H) in Alzheimer's disease by iTRAQ.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
More...