Property Summary

NCBI Gene PubMed Count 131
PubMed Score 0.00
PubTator Score 458.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 3.208 2.3e-03
adult high grade glioma -4.100 4.0e-06
astrocytic glioma -3.300 3.5e-03
Astrocytoma, Pilocytic -4.900 2.7e-11
atypical teratoid / rhabdoid tumor -4.100 3.3e-07
colon cancer -2.400 4.7e-02
ependymoma -4.400 5.5e-04
glioblastoma -4.000 2.8e-09
group 3 medulloblastoma -2.700 1.9e-03
lung cancer 1.100 3.6e-03
lung carcinoma 1.600 7.7e-07
malignant mesothelioma 1.200 1.5e-05
non-small cell lung cancer 1.482 1.2e-05
oligodendroglioma -2.600 2.8e-02
periodontitis -1.800 4.9e-25
Pick disease -2.500 1.8e-02
tuberculosis 1.200 4.4e-04

Protein-protein Interaction (10)

Gene RIF (79)

AA Sequence

MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLEN      1 - 70
LDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYE     71 - 140
QEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELE    141 - 210
KRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWF    211 - 280
KSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT    281 - 350
INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG    351 - 420
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEE    421 - 490
AAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD                     491 - 543
//

Text Mined References (131)

PMID Year Title