Property Summary

NCBI Gene PubMed Count 119
PubMed Score 0.00
PubTator Score 458.70

Knowledge Summary

Patent

No data available

Synonym

Accession P07196 B9ZVN2 Q16154 Q8IU72 NF-L
Symbols NFL
NF-L
NF68
CMT1F
CMT2E
PPP1R110

Gene

 Compartment GO Term (0)

Gene RIF (69)

PMID Text
26870824 Plasma Concentration of the Neurofilament Light Protein (NFL) is a Biomarker of CNS Injury in HIV Infection
26801564 Finally, we demonstrated that NEFL inhibited the NF-kappaB pathway, thereby suppressing the expression of uPA and decreasing NSCLC invasiveness and migration.
26524180 Cerebrospinal fluid NFL concentration is increased by the early clinical stage of Alzheimer's Disease.
26209061 The results showed an important role for miR-25 in regulating NEFL expression in Glioblastoma multiforme.
26016807 Data suggest that, while lacking a stable structure, NFL-TBS.40-63 peptide (a peptide derived from light neurofilament protein) preferentially binds on a specific single site located near C-terminal end of beta-tubulin.
25934855 Blood-derived NfL level is an easily accessible biomarker with prognostic value in ALS.
25877835 The results od this study concluded that NEFL E396K mutation may manifest with a novel DI-CMT phenotype, characterized by simultaneous involvement of the peripheral and central nervous system.
25724651 Data indicate that the N terminus of Pro-EMAP II binds to its C terminus, arginyl-tRNA synthetase, and the neurofilament light subunit.
25605243 The miR-381-NEFL axis is important for temozolomide resistance in glioblastoma multiforme.
25583183 a novel heterozygous missense mutation c.1166A>G (p.Y389C) in the gene encoding the light-chain neurofilament protein was identified in 4 patients resulting in hereditary motor and sensory neuropathy with pyramidal signs phenotype.
More...

AA Sequence

MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLEN      1 - 70
LDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYE     71 - 140
QEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELE    141 - 210
KRIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWF    211 - 280
KSRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDT    281 - 350
INKLENELRTTKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG    351 - 420
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEE    421 - 490
AAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD                     491 - 543
//

Text Mined References (119)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26870824 2016 Plasma Concentration of the Neurofilament Light Protein (NFL) is a Biomarker of CNS Injury in HIV Infection: A Cross-Sectional Study.
26801564 2016 Methylation of neurofilament light polypeptide promoter is associated with cell invasion and metastasis in NSCLC.
26524180 2016 Association of Cerebrospinal Fluid Neurofilament Light Concentration With Alzheimer Disease Progression.
26209061 2015 miR-25 promotes glioblastoma cell proliferation and invasion by directly targeting NEFL.
26016807 2015 Investigating the Structural Variability and Binding Modes of the Glioma Targeting NFL-TBS.40-63 Peptide on Tubulin.
25934855 2015 Neurofilament light chain: A prognostic biomarker in amyotrophic lateral sclerosis.
25877835 2015 NEFL E396K mutation is associated with a novel dominant intermediate Charcot-Marie-Tooth disease phenotype.
25724651 2015 The N terminus of pro-endothelial monocyte-activating polypeptide II (EMAP II) regulates its binding with the C terminus, arginyl-tRNA synthetase, and neurofilament light protein.
More...