Property Summary

Ligand Count 16
NCBI Gene PubMed Count 70
PubMed Score 306.01
PubTator Score 151.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.800 1.1e-04
breast carcinoma -1.100 1.0e-18
dermatomyositis 1.200 3.7e-02
ductal carcinoma in situ -1.100 3.1e-03
group 4 medulloblastoma -1.500 2.2e-05
intraductal papillary-mucinous adenoma (... -3.100 1.5e-05
intraductal papillary-mucinous carcinoma... -2.500 9.0e-03
intraductal papillary-mucinous neoplasm ... -3.500 1.5e-03
invasive ductal carcinoma -1.400 2.1e-03
lung cancer -1.800 2.0e-03
lung carcinoma -2.000 7.3e-19
Multiple myeloma 1.894 8.6e-04
ovarian cancer -1.100 4.9e-02
pancreatic cancer -1.100 4.9e-03
primary pancreatic ductal adenocarcinoma -1.153 4.8e-03
Waldenstrons macroglobulinemia 1.346 8.6e-03

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS      1 - 70
LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP     71 - 140
VDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGV    141 - 210
SLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKG    211 - 280
MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL                    281 - 334
//

Text Mined References (77)

PMID Year Title