Property Summary

NCBI Gene PubMed Count 65
Grant Count 2
Funding $140,071.6
PubMed Score 298.76
PubTator Score 151.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P07195 LDH-B
Symbols LDH-B
LDH-H
LDHBD
TRG-5
HEL-S-281

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

1I0Z   1T2F  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
743192 confirmatory 0 / 0 / 10 Extended Characterization of HPGD Inhibitors: Counterscreen Against LDHB

Gene RIF (40)

PMID Text
26214432 The aim of this study was to demonstrate the effects of 6-week low-intensity training on changes in indicators of aerobic capacity and on HSPA1A, HSPB1, and LDHb expression in white blood cells in high level rowers.
26032856 addition of exogenous lactic acid to growth media was sufficient to induce cell death that could be inhibited by the expression of LDHB. the results suggest that lactate dehydrogenase is a general suppressor of programmed cell death in yeast.
25973606 Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma.
25524555 In this study, we inhibited LDH using oxamate resulting in the inhibition of proliferation and induction of apoptosis in gastric cancer
25505242 The interaction of HIV-1 CA with human cellular lactate dehydrogenase B protein (LDHB) is identified by yeast two-hybrid screen
25247702 The readthrough-extended lactate dehydrogenase subunit LDHBx can also co-import LDHA, the other LDH subunit, into peroxisomes.
24708595 We were able to provide evidence that methylation of HLTF and especially HPP1 detected in serum is strongly correlated with cell death in CRC using LDH as surrogate marker
24682390 This meta-analysis shows that high serum LDH level is obviously associated with lower overall survival rate in patients with osteosarcoma, and it is an effective biomarker of prognosis.
23697991 These observations support prospective clinical evaluation of LDHB as a predictive marker of response for patients with breast cancer receiving neoadjuvant chemotherapy.
23516535 the role played by ERRalpha in the regulation of lactate dehydrogenases A and B
More...

AA Sequence

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS      1 - 70
LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP     71 - 140
VDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGV    141 - 210
SLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKG    211 - 280
MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL                    281 - 334
//

Text Mined References (72)

PMID Year Title
26214432 2015 Effects of 6-week specific low-intensity training on selected aerobic capacity parameters and HSPA1A, HSPB1, and LDHb gene expression in high-level rowers.
26032856 2015 Inhibition of stress mediated cell death by human lactate dehydrogenase B in yeast.
25973606 2015 Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25524555 2015 Oxamate-mediated inhibition of lactate dehydrogenase induces protective autophagy in gastric cancer cells: involvement of the Akt-mTOR signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25340584 2014 Ribosomal readthrough at a short UGA stop codon context triggers dual localization of metabolic enzymes in Fungi and animals.
25247702 2014 Peroxisomal lactate dehydrogenase is generated by translational readthrough in mammals.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
More...