Property Summary

NCBI Gene PubMed Count 108
Grant Count 116
R01 Count 84
Funding $8,614,670.83
PubMed Score 428.73
PubTator Score 294.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
nephrosclerosis -2.083 0.044
pancreatic ductal adenocarcinoma liver m... -3.435 0.048
colon cancer -3.400 0.030
active Crohn's disease -1.051 0.016
active ulcerative colitis -1.322 0.030
psoriasis -1.900 0.000

Synonym

Accession P07148
Symbols FABPL
L-FABP

Gene

PDB

2F73   2L67   2L68   2LKK   2PY1   3B2H   3B2I   3B2J   3B2K   3B2L   3STK   3STM   3STN   3VG2   3VG3   3VG4   3VG5   3VG6   3VG7  

Gene RIF (88)

PMID Text
26997447 Loss of staining for LFABP appears to be common in hepatocellular carcinoma and may be seen in well-differentiated hepatocellular carcinoma.
26650609 In the association of SNPs in FABP1 gene with PCOS, rs2197076 was more closely associated with its main features than rs2241883 and seemed to play a more important role in the pathogenesis of PCOS.
26637457 In this study, the effects of hepatitis B virus X protein (HBx) mediated FABP1 regulation on hepatic steatosis and the underlying mechanism were determined.
26585768 Urinary L-FABP appears to be a sensitive biomarker of acute kidney injury in patients undergoing abdominal aortic repair.
26439934 compared with the rs2919872 G allele, the rs2919872 A allele reduces the transcriptional activity of FABP1 promoter, and thereby may link FABP1 gene variation to triglyceride level in humans.
26324091 Urinary levels of NGAL are more sensitive than uKIM-1 and uL-FABP levels in predicting renal scarring in vesicoureteral reflux.
26254248 Higher urinary L-FABP was found in pregnant with and without gestational diabetes mellitus(GDM), and considerably higher urinary L-FABP was found in the GDM group compared with the non-GDM group.
26067610 Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels.
26010898 Urinary L-FABP is strongly associated with anemia in non-diabetic patients.
25847235 FABP1 and FABP2 have roles in differentially modulating the activation of PPARalpha in a ligand-selective manner
More...

AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE      1 - 70
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI                  71 - 127
//

Text Mined References (111)

PMID Year Title
26997447 2016 Expression of liver fatty acid binding protein in hepatocellular carcinoma.
26650609 2016 Association of single-nucleotide polymorphisms rs2197076 and rs2241883 of FABP1 gene with polycystic ovary syndrome.
26637457 2015 Hepatitis B Virus X Protein Induces Hepatic Steatosis by Enhancing the Expression of Liver Fatty Acid Binding Protein.
26585768 2016 Clinical usefulness of urinary liver-type fatty-acid-binding protein as a perioperative marker of acute kidney injury in patients undergoing endovascular or open-abdominal aortic aneurysm repair.
26439934 2015 Association of a Human FABP1 Gene Promoter Region Polymorphism with Altered Serum Triglyceride Levels.
26324091 2016 Role of new biomarkers for predicting renal scarring in vesicoureteral reflux: NGAL, KIM-1, and L-FABP.
26254248 2015 Urinary liver-type fatty acid-binding protein change in gestational diabetes mellitus.
26067610 2015 Urinary ACE2 is associated with urinary L-FABP and albuminuria in patients with chronic kidney disease.
26010898 2015 Distinct roles of urinary liver-type fatty acid-binding protein in non-diabetic patients with anemia.
25847235 2015 Fatty Acid-binding Proteins 1 and 2 Differentially Modulate the Activation of Peroxisome Proliferator-activated Receptor ? in a Ligand-selective Manner.
More...