Property Summary

Ligand Count 5
NCBI Gene PubMed Count 118
PubMed Score 448.76
PubTator Score 294.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease -1.051 1.6e-02
active ulcerative colitis -1.322 3.0e-02
colon cancer -2.800 2.9e-03
nephrosclerosis -2.083 4.4e-02
pancreatic ductal adenocarcinoma liver m... -3.435 4.8e-02
psoriasis -1.900 1.8e-05

Protein-protein Interaction (1)

PDB (19)

Gene RIF (97)

AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE      1 - 70
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI                  71 - 127
//

Text Mined References (121)

PMID Year Title