Property Summary

Ligand Count 2
NCBI Gene PubMed Count 118
PubMed Score 448.76
PubTator Score 294.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease -1.051 1.6e-02
active ulcerative colitis -1.322 3.0e-02
colon cancer -2.800 2.9e-03
nephrosclerosis -2.083 4.4e-02
pancreatic ductal adenocarcinoma liver m... -3.435 4.8e-02
psoriasis -1.900 1.8e-05

Synonym

Accession P07148
Symbols FABPL
L-FABP

Gene

PDB

2F73   2L67   2L68   2LKK   2PY1   3B2H   3B2I   3B2J   3B2K   3B2L   3STK   3STM   3STN   3VG2   3VG3   3VG4   3VG5   3VG6   3VG7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (97)

AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE      1 - 70
LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI                  71 - 127
//

Text Mined References (121)

PMID Year Title