Property Summary

NCBI Gene PubMed Count 60
Grant Count 69
R01 Count 43
Funding $12,365,615.74
PubMed Score 242.76
PubTator Score 240.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic lymphosyte leukemia 1.300 0.000
Multiple myeloma 2.267 0.001
oligodendroglioma 1.600 0.030
astrocytoma 1.300 0.000
glioblastoma multiforme 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -2.305 0.001
pediatric high grade glioma 1.300 0.000
ovarian cancer 2.600 0.000
pituitary cancer 1.800 0.000

Synonym

Accession P07108 B8ZWD2 B8ZWD6 B8ZWD7 P08869 Q4VWZ6 Q53SQ7 Q6IB48 Q9UCI8 ACBP
Symbols EP
ACBP
ACBD1
CCK-RP

Gene

DBI

PANTHER Protein Class (1)

PDB

2CB8   2FJ9  

Gene RIF (26)

PMID Text
26290636 Serum endozepine-4 levels are increased in hepatic coma.
25898985 Structural and functional properties of ACBD1, commonly known as ACBP. [Review]
24819876 High ACBP expression is associated with non-small cell lung cancer.
24818357 There was a significant difference in the rs2276596 polymorphism C/A allele frequency of the DBI gene (P < 0.0001) between alcoholics and healthy controls.
24401326 results indicate that a dysfunction of the neurosteroid system might be operative in BPD in spite of unchanged DBI plasma levels.
24080521 Acyl-CoA binding protein and epidermal barrier function. [review]
23727119 Endogenous potentiation of GABAergic synaptic transmission and responses to GABA uncaging in the thalamic reticular nucleus is absent in mice in which DBI is deleted and mice in which benzodiazepine binding to alpha3 subunit-containing GABAARs is disrupted.
21448843 A human preadipocyte cell line SGBS is well suited to examine differential expression of the Acyl-CoA binding protein (ACBP) during adipogenesis.
20511713 Gene annotation enrichment analysis revealed ACBP-mediated down-regulation of 18 genes encoding key enzymes in glycerolipid, cholesterol and fatty acid metabolism.
20345851 The regulation of novel low-abundance transcript variants of human acyl-CoA binding protein, was analysed.
More...

AA Sequence

MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDA      1 - 70
MKAYINKVEELKKKYGI                                                          71 - 87
//

Text Mined References (70)

PMID Year Title
26290636 2015 Endozepine-4 levels are increased in hepatic coma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898985 2015 Long-chain acyl-CoA esters in metabolism and signaling: Role of acyl-CoA binding proteins.
24819876 2014 Acyl-coenzyme A-binding protein regulates Beta-oxidation required for growth and survival of non-small cell lung cancer.
24818357 2014 Relationship between alcohol dependence and the DBI rs2276596 (C/A) polymorphism in Japanese.
24401326 2014 Diazepam binding inhibitor and dehydroepiandrosterone sulphate plasma levels in borderline personality disorder adolescents.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24080521 2014 Acyl-CoA binding protein and epidermal barrier function.
23727119 2013 Endogenous positive allosteric modulation of GABA(A) receptors by diazepam binding inhibitor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...