Property Summary

NCBI Gene PubMed Count 61
PubMed Score 248.36
PubTator Score 240.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.300 9.6e-20
Chronic Lymphocytic Leukemia 1.250 8.8e-03
glioblastoma 1.100 3.3e-05
Multiple myeloma 2.267 1.5e-03
oligodendroglioma 1.400 3.0e-02
ovarian cancer 2.600 1.5e-06
pancreatic ductal adenocarcinoma liver m... -1.406 1.6e-02
pediatric high grade glioma 1.300 1.1e-06
pituitary cancer 1.500 3.4e-04

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDA      1 - 70
MKAYINKVEELKKKYGI                                                          71 - 87
//

Text Mined References (71)

PMID Year Title