Property Summary

NCBI Gene PubMed Count 203
Grant Count 1,041
R01 Count 669
Funding $131,146,055.27
PubMed Score 2047.10
PubTator Score 1081.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical adenoma -1.768 0.014
adrenocortical carcinoma -1.762 0.000
interstitial cystitis -1.100 0.001
aldosterone-producing adenoma -3.578 0.011

Synonym

Accession P07101 B7ZL70 B7ZL73 Q0PWM2 Q0PWM3 Q15585 Q15588 Q15589 Q2M3B4
Symbols TYH
DYT14
DYT5b

Gene

TH

PDB

4J6S   2XSN  

Gene RIF (180)

PMID Text
26732803 The data suggest that presence of a homozygous V81M polymorphism is associated with more severe freezing of gait in patients with Parkinson's disease
26498952 In high-risk metastatic Neuroblastoma, TH and DCX mRNA quantification could be used for the assessment of response to treatment and for early detection of progressive disease or relapses.
26386900 In this study we found that TH protein levels did not differ between control and schizophrenia groups in the nucleus accumbens.
26276013 The mutant tyrosine hydroxylase enzyme was unstable and exhibited deficient stabilization by catecholamines, leading to decline of brain tyrosine hydroxylase-immunoreactivity in the Th knock-in mice.
26220941 This study showed that a new tyrosine hydroxylase knock-in mouse model of l-DOPA-responsive dystonia.
25462571 Thus, the hTH-GFP reporter rat should be a valuable tool for Parkinson's disease research.
25418103 A detailed analysis of the interaction between singly or doubly phosphorylated human tyrosine hydroxylase isoform 1(1-50) peptides and 14-3-3zeta
24975687 the allelic frequency of the TH01 marker in 171 Swiss sudden infant death syndrome (SIDS) infants and 500 healthy and gender-matched Caucasian adults showed that the 9.3 allele is similarly distributed in SIDS cases and controls (27.2% vs. 25.6%; p-value = 0.562).
24947669 Proteomics analysis show that Ser40 of TH protein does not significantly contribute to the binding of 14-3-3gamma, and rather has reduced accessibility in the TH:14-3-3gamma complex.
24891139 Neurons of the substantia nigra from the Lesch-Nyhan disease cases show reduced melanization and reduced reactivity for tyrosine hydroxylase (TH), the rate-limiting enzyme in dopamine synthesis.
More...

AA Sequence

MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQ      1 - 70
SLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAK     71 - 140
IHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHL    141 - 210
VTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACG    211 - 280
EHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASS    281 - 350
PMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG    351 - 420
AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKF    421 - 490
DPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG                                    491 - 528
//

Text Mined References (215)

PMID Year Title
26732803 2016 The V81M variant of tyrosine hydroxylase is associated with more severe freezing of gait in Parkinson's disease.
26498952 2016 TH and DCX mRNAs in peripheral blood and bone marrow predict outcome in metastatic neuroblastoma patients.
26386900 2015 Uncovering the role of the nucleus accumbens in schizophrenia: A postmortem analysis of tyrosine hydroxylase and vesicular glutamate transporters.
26276013 2015 Brain catecholamine depletion and motor impairment in a Th knock-in mouse with type B tyrosine hydroxylase deficiency.
26220941 2015 A new knock-in mouse model of l-DOPA-responsive dystonia.
25462571 2014 The hTH-GFP reporter rat model for the study of Parkinson's disease.
25418103 2014 Dissection of binding between a phosphorylated tyrosine hydroxylase peptide and 14-3-3zeta: A complex story elucidated by NMR.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
24975687 2014 Tyrosine hydroxylase TH01 9.3 allele in the occurrence of sudden infant death syndrome in Swiss Caucasians.
24947669 2014 Phosphorylation dependence and stoichiometry of the complex formed by tyrosine hydroxylase and 14-3-3?.
More...