Property Summary

Ligand Count 4
NCBI Gene PubMed Count 210
PubMed Score 2144.65
PubTator Score 1081.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Pheochromocytoma 24
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Parkinson's disease 392 7.726 3.9

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical adenoma -1.768 1.4e-02
adrenocortical carcinoma -1.762 3.0e-04
aldosterone-producing adenoma -3.578 1.1e-02
interstitial cystitis -1.100 1.2e-03

Protein-protein Interaction (9)

Gene RIF (186)

AA Sequence

MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQ      1 - 70
SLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPRATKPSALSRAVKVFETFEAK     71 - 140
IHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVRQVSEDVRSPAGPKVPWFPRKVSELDKCHHL    141 - 210
VTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACG    211 - 280
EHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASS    281 - 350
PMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG    351 - 420
AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKF    421 - 490
DPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG                                    491 - 528
//

Text Mined References (222)

PMID Year Title