Property Summary

NCBI Gene PubMed Count 340
Grant Count 86
R01 Count 63
Funding $14,190,144.86
PubMed Score 590.48
PubTator Score 435.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession P07099 B2R8N0 Q5VTJ6 Q9NP75 Q9NPE7 Q9NQU6 Q9NQU7 Q9NQU8 Q9NQU9 Q9NQV0 Q9NQV1 Q9NQV2
Symbols MEH
EPHX
EPOX
HYL1

Gene

Gene RIF (376)

PMID Text
26555147 The SCN1A IVS5-91G>A SNP is associated with susceptibility to epilepsy. SNPs in EPHX1 gene are influencing CBZ metabolism and disposition
26295053 In conclusion, GSTs, EPHX1, and XPD are potential genetic factors for arsenic-induced skin cancers. The roles of these genes for arsenic-induced skin carcinogenesis need to be further evaluated.
26216302 Studies suggest that the presence of microsomal epoxide hydrolase 1 (EPHX1) single nucleotide polymorphisms (SNPs) may significantly affect the risk of lung, upper aerodigestive tract, breast, bladder, and ovarian carcinomas.
26179485 Null-GSTT1 and null-GSTM1 genotypes and Cytochrome P4502E1 (CYP2E1: rs2031920, rs3813867) may support the hematotoxicity of benzene-exposed workers in China, and we can make use of it to select susceptible population
26065263 This meta-analysis suggests that EPHX1 Tyr113His polymorphism contributes to HCC risk.
25999707 Polymorphism in the EPHX1 gene may have a significant role in differential responses to treatment with N-acetylcysteine in patients with COPD.
25992604 To be poly(ADP-ribose)polymerase-1 (PARP-1) bound to the EPHX1 proximal promoter.
25923690 This review and meta-analysis suggests that EPHX1 Tyr113His polymorphism may be a risk factor for Head and Neck Cancer, while the EPHX1 His139Arg polymorphism has no association with Head and Neck Cancer risk.
25714851 EPHX1 Tyr113His and His139Arg polymorphism are not associated with esophageal cancer risk.
25629049 EPHX1 rs2292566 polymorphism may affect the maintenance dose of warfarin in Caucasians.
More...

AA Sequence

MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF      1 - 70
RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT     71 - 140
PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK    141 - 210
LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE    211 - 280
LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS    281 - 350
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL    351 - 420
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ                                       421 - 455
//

Text Mined References (344)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26555147 2015 Polymorphic Variants of SCN1A and EPHX1 Influence Plasma Carbamazepine Concentration, Metabolism and Pharmacoresistance in a Population of Kosovar Albanian Epileptic Patients.
26295053 2015 Association of Environmental Arsenic Exposure, Genetic Polymorphisms of Susceptible Genes, and Skin Cancers in Taiwan.
26216302 2015 Microsomal epoxide hydrolase 1 (EPHX1): Gene, structure, function, and role in human disease.
26179485 Are polymorphisms in metabolism protective or a risk for reduced white blood cell counts in a Chinese population with low occupational benzene exposures?
26065263 [EPHX1 Tyr113His polymorphism contributes to hepatocellular carcinoma risk: evidfnce from a meta-analysis].
25999707 2015 Effect of N-acetylcysteine in COPD patients with different microsomal epoxide hydrolase genotypes.
25992604 2015 Transcription of the Human Microsomal Epoxide Hydrolase Gene (EPHX1) Is Regulated by PARP-1 and Histone H1.2. Association with Sodium-Dependent Bile Acid Transport.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25923690 2015 Systematic Review and Meta-Analysis of the Relationship between EPHX1 Polymorphisms and the Risk of Head and Neck Cancer.
More...