Property Summary

Ligand Count 166
NCBI Gene PubMed Count 352
PubMed Score 601.88
PubTator Score 435.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
PEE1 2
hepatocellular carcinoma 547

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.000 1.3e-08
active Crohn's disease -2.063 4.1e-02
active ulcerative colitis -1.202 1.6e-02
atypical teratoid / rhabdoid tumor 2.600 3.1e-05
Breast cancer 1.100 1.3e-04
dermatomyositis -1.600 1.6e-04
Down syndrome 1.800 4.2e-04
ductal carcinoma in situ -1.300 2.0e-02
esophageal adenocarcinoma -1.300 2.1e-02
fibroadenoma -1.300 3.9e-02
gastric cancer -1.200 3.5e-02
glioblastoma 2.300 1.6e-07
interstitial cystitis -1.400 5.5e-03
intraductal papillary-mucinous adenoma (... -1.500 3.1e-03
intraductal papillary-mucinous carcinoma... -1.600 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.1e-02
invasive ductal carcinoma -1.500 1.1e-02
lung cancer -1.300 1.1e-03
medulloblastoma, large-cell 1.100 3.1e-02
oligodendroglioma 1.200 7.5e-03
ovarian cancer -1.400 4.9e-05
pancreatic cancer -1.400 9.7e-05
pancreatic ductal adenocarcinoma liver m... -3.497 4.6e-03
pituitary cancer -1.100 2.9e-02
psoriasis -1.400 2.0e-10
Rheumatoid arthritis -2.200 9.3e-03

Protein-protein Interaction (2)

Gene RIF (387)

AA Sequence

MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF      1 - 70
RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT     71 - 140
PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK    141 - 210
LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE    211 - 280
LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS    281 - 350
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL    351 - 420
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ                                       421 - 455
//

Text Mined References (356)

PMID Year Title