Property Summary

Ligand Count 1
NCBI Gene PubMed Count 36
PubMed Score 46.12
PubTator Score 186.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Obesity 678
Disease Target Count P-value
posterior fossa group B ependymoma 416 1.3e-06
Disease Target Count Z-score Confidence
Wolman disease 6 5.668 2.8
Cholesterol ester storage disease 6 4.605 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 1.3e-06

Gene RIF (15)

AA Sequence

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN      1 - 70
SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF     71 - 140
SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL    141 - 210
INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS    211 - 280
HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD    281 - 350
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK                          351 - 398
//

Text Mined References (39)

PMID Year Title