Property Summary

NCBI Gene PubMed Count 78
Grant Count 237
R01 Count 124
Funding $41,774,873.63
PubMed Score 382.27
PubTator Score 632.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P07093 B2R6A4 B4DIF2 Q53S15 Q5D0C4 GDN
Symbols GDN
PI7
PN1
PNI
PI-7
PN-1
GDNPF

Gene

PDB

4DY7   4DY0  

Gene RIF (62)

PMID Text
26305372 together, these data demonstrate that SERPINE2 might prevent cartilage catabolism by inhibiting the expression of MMP-13, one of the most relevant collagenases, involved in cartilage breakdown in OA.
26214473 The results suggest that the rs3795879 polymorphism of SERPINE2 is not a risk factor for chronic obstructive pulmonary disease.
25901736 aberrant Serpine2/Pn-1 is required for proliferation of human and mouse medulloblastoma cells.
25517131 MAGI2, SERPINE2, and NT5C3B expression levels are associated with airway wall thickening and additionally with bronchial inflammation, emphysema, and lung function, respectively, all features of chronic obstructive pulmonary disease.
25359682 Our findings indicate that upregulated SERPINE2 may contribute to the aggressive phenotype of gastric cancer and suggest that SERPINE2 can be used as a novel prognostic factor and anticancer target in patients with gastric cancer.
25199049 role in lung homeostasis and pulmonary fibrosis
24587150 Haplotypes carrying major alleles of rs729631 (C), rs975278 (G), rs7583463 (C) of SERPINE2 had protective effect on lung function amongst South Indian male smokers with COPD.
24023701 SERPINE2 and PLAU are involved in cumulus expansion and oocyte maturation.
23661674 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23385179 Studies suggest that protease nexin 1 as a marker of prostate cancer.
More...

AA Sequence

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD      1 - 70
GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN     71 - 140
VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA    141 - 210
DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW    211 - 280
MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED    281 - 350
GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP                          351 - 398
//

Text Mined References (81)

PMID Year Title
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
26214473 2015 Association between the rs3795879 G/A polymorphism of the SERPINE2 gene and chronic obstructive pulmonary disease: a meta-analysis.
25901736 2015 Serpine2/PN-1 Is Required for Proliferative Expansion of Pre-Neoplastic Lesions and Malignant Progression to Medulloblastoma.
25517131 2015 Novel genes for airway wall thickness identified with combined genome-wide association and expression analyses.
25416956 2014 A proteome-scale map of the human interactome network.
25359682 2015 Prognostic significance of SERPINE2 in gastric cancer and its biological function in SGC7901 cells.
25199049 2014 Increased expression of protease nexin-1 in fibroblasts during idiopathic pulmonary fibrosis regulates thrombin activity and fibronectin expression.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24587150 2014 Genetic determinants of chronic obstructive pulmonary disease in South Indian male smokers.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
More...