Property Summary

NCBI Gene PubMed Count 82
PubMed Score 376.46
PubTator Score 632.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -2.900 3.0e-02
atypical teratoid / rhabdoid tumor -2.800 7.1e-05
colon cancer 1.400 2.7e-02
cutaneous lupus erythematosus 1.100 2.1e-02
cystic fibrosis 4.278 3.3e-08
Duchenne muscular dystrophy 1.889 3.1e-07
ductal carcinoma in situ 1.600 4.3e-04
ependymoma -1.200 3.9e-02
gastric carcinoma 2.800 2.9e-03
group 3 medulloblastoma -2.800 6.6e-07
interstitial cystitis 2.500 9.8e-05
intraductal papillary-mucinous adenoma (... -2.400 1.2e-02
lung adenocarcinoma 1.300 1.1e-06
lung cancer 1.800 4.4e-05
lung carcinoma 1.600 1.4e-10
medulloblastoma, large-cell -3.900 1.3e-06
non-small cell lung cancer 2.299 6.3e-16
ovarian cancer -2.100 2.4e-02
pancreatic cancer 2.400 7.3e-03
primary pancreatic ductal adenocarcinoma 1.961 2.4e-02
primary Sjogren syndrome 1.400 7.4e-03
pterygium 1.200 4.2e-03
ulcerative colitis 1.700 1.9e-04

Protein-protein Interaction (1)

Gene RIF (66)

AA Sequence

MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD      1 - 70
GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN     71 - 140
VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA    141 - 210
DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW    211 - 280
MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED    281 - 350
GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP                          351 - 398
//

Text Mined References (85)

PMID Year Title