Property Summary

Ligand Count 64
NCBI Gene PubMed Count 386
PubMed Score 8831.26
PubTator Score 1911.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (324)

AA Sequence

MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQ      1 - 70
EREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA                 71 - 128
//

Text Mined References (387)

PMID Year Title