Property Summary

NCBI Gene PubMed Count 343
PubMed Score 8776.72
PubTator Score 1911.59

Knowledge Summary

Patent

No data available

Synonym

Accession P06881 Q93048 Q9UCP0
Symbols CT
KC
PCT
CGRP
CALC1
CGRP1
CGRP-I

Gene

PDB

1LS7  

Gene RIF (281)

PMID Text
27096761 The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases.
27012052 PCT does not seem to be suitable for detecting pancreatic fistula after pancreatoduodenectomy.
26986140 blood PCT sufficient to confirm or exclude bacterial meningitis diagnosis [meta-analysis]
26666342 Patients with acute heart failure and bacterial infections had significantly elevated levels of procalcitonin and poorer outcomes.
26636517 Procalcitonin serum levels were significant biomarker for the diagnosis of bacterial pneumonia in children.
26596282 These experimental observations, suggesting that hCt senses Ca(2+) concentration variations, strengthen the hypothesis that channel formation represents an extra source of Ca(2+) entry into osteoclasts
26495299 Procalcitonin, uric acid, and BNP had significant relationship with many echocardiographic findings in participants. For patients, procalcitonin did not show correlation.
26482503 miR-125b modulates PCT expression by manipulating the amount and transcriptional activity of Stat3.
26481456 Calcitonin is specifically expressed in sera of medullary thyroid carcinoma patients. (Review)
26271020 Among adrenomedullin, CRP, and PCT, procalcitonin demonstrates the highest correlation with the severity of infection.
More...

AA Sequence

MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQ      1 - 70
EREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA                 71 - 128
//

Text Mined References (344)

PMID Year Title
27096761 2016 Prospective Evaluation of Procalcitonin, Soluble Triggering Receptor Expressed on Myeloid Cells-1 and C-Reactive Protein in Febrile Patients with Autoimmune Diseases.
27012052 2016 Procalcitonin--a Marker for Anastomotic Insufficiency after Pancreatoduodenectomy?
26986140 2016 Diagnostic Accuracy of Procalcitonin in Bacterial Meningitis Versus Nonbacterial Meningitis: A Systematic Review and Meta-Analysis.
26666342 2016 Procalcitonin-based indication of bacterial infection identifies high risk acute heart failure patients.
26636517 2015 Clinical significance of serum procalcitonin level monitoring on early diagnosis of severe pneumonia on children.
26596282 2016 Effect of calcium ions on human calcitonin. Possible implications for bone resorption by osteoclasts.
26495299 2015 Comparison between procalcitonin, brain natriuretic peptide, and uric acid in children with cardiomyopathy and controls.
26482503 2016 miR-125b regulates procalcitonin production in monocytes by targeting Stat3.
26481456 2016 Use of fine-needle aspirate calcitonin to detect medullary thyroid carcinoma: A systematic review.
26271020 2015 Adrenomedullin--A New Marker in Febrile Neutropenia: Comparison With CRP and Procalcitonin.
More...