Property Summary

NCBI Gene PubMed Count 343
PubMed Score 8776.72
PubTator Score 1911.59

Knowledge Summary

Patent

No data available

Protein-protein Interaction (11)

Gene RIF (281)

PMID Text
27096761 The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases.
27012052 PCT does not seem to be suitable for detecting pancreatic fistula after pancreatoduodenectomy.
26986140 blood PCT sufficient to confirm or exclude bacterial meningitis diagnosis [meta-analysis]
26666342 Patients with acute heart failure and bacterial infections had significantly elevated levels of procalcitonin and poorer outcomes.
26636517 Procalcitonin serum levels were significant biomarker for the diagnosis of bacterial pneumonia in children.
26596282 These experimental observations, suggesting that hCt senses Ca(2+) concentration variations, strengthen the hypothesis that channel formation represents an extra source of Ca(2+) entry into osteoclasts
26495299 Procalcitonin, uric acid, and BNP had significant relationship with many echocardiographic findings in participants. For patients, procalcitonin did not show correlation.
26482503 miR-125b modulates PCT expression by manipulating the amount and transcriptional activity of Stat3.
26481456 Calcitonin is specifically expressed in sera of medullary thyroid carcinoma patients. (Review)
26271020 Among adrenomedullin, CRP, and PCT, procalcitonin demonstrates the highest correlation with the severity of infection.
26191294 CGRP 4218T/C polymorphism may be associated with the postoperative fentanyl consumption for analgesia.
26188130 Serum procalcitonin is a highly accurate marker that can be used for rapid differentiation between bacterial and viral causes of meningitis in adults.
26046926 PCT level was not significantly different in neutropenic systemic inflammatory response syndrome patients and sepsis patients.
26018813 CGRP1 was reliably and reproducibly measured in saliva from COPD patients and was found to be increased.
25997247 The plasma CGRP level is increased in psoriasis patients and CALCA T-692C polymorphism TT genotype is a factor for the affectability in alcohol-drinking Psoriasis vulgaris patients
25992537 PCT may represent a useful tool for differentiating gram-positive from gram-negative bloodstream infection with a significantly higher PCT level indicating gram-negative bacteremia.
25975456 The maternal serum copeptin, MR-proANP and PCT [Procalcitonin] levels are higher in EO-PE [early-onset Preeclampsia] and LO-PE [Late onset Preeclampsia ]patients, but the difference is not significant.
25963492 Our results showed PCT as a valuable marker of bacterial infections in febrile patients. PCT was superior to CRP, IL-6 or SAA in the early identification of bacterial infection
25926728 C-reactive protein/procalcitonin could not differentiate between bacterial and viral infections in patients with COPD exacerbation requiring ED visits.
25923821 Peripheral actions of CGRP in the joint might contribute to both inflammation and joint afferent sensitization.
25872263 The admixture of blood as a result of traumatization of mucous membrane under application of naso-jejunal probe is one of main causes of occurrence of procalcitonin in content of intestine.
25750561 Suggest that serum PCT at a cutoff value of 0.75 ng/mL is an appropriate indicator of infection in ESRD patients.
25697203 Procalcitonin, like C-reactive protein, is elevated in bacterial gastroenteritis (p=0.001), but these markers are not a predictor of hospitalization.
25691533 Plasma copeptin, CRP and procalcitonin concentrations were positively correlated with APACHE II score in patients with sepsis, and reflected disease severity.
25638513 In absence of other nosocomial infections, early high serum PCT concentrations appear to be a reliable indicator of bacterial CNS infection in patients with external ventricular drains.
25578529 In the inflammatory process of arthritis in developmental dysplasia of the hip, there is increased expression of calcitonin gene-related peptide in synovial fluid.
25578228 Data show that the area under the curve for adult septic shock stratification and information technology (ASSIST) was greater than that of interleukin-6 (IL6) and procalcitonin (PCT).
25575698 Procalcitonin improves the diagnostic accuracy of existing markers of bacteraemia
25469944 Serum procalcitonin has a potential role in diagnosing acute bacterial septic arthritis.
25445228 The combined use of cerebrospinal fluid procalcitonin and lactate can reliably distinguish between post-neurosurgical bacterial meningitis (PNBM) and non-PNBM.
25436308 High levels of procalcitonin after pediatric liver transplantation are an early indicator of poor postoperative outcome and may reflect ischemia induced liver cell injury within the context of an ischemia- reperfusion injury.
25370803 Procalcitonin serum levels were an independent predictor of short-term functional outcome after ischemic stroke in a Chinese population.
25319789 Procalcitonin can serve as a biomarker for diagnosing sepsis and assessing disease severity.
25319702 Pharmacological blockade of CGRP leads to a drastically attenuated itch sensation.
25298068 serum values in bullous impetigo and staphylococcal scalded skin syndrome patients significantly higher than in healthy controls
25293477 An increase in procalcitonin levels is an indirect sign of diffuse secondary peritonitis and this is associated with increased risk of septic shock; Increased PCT level on admission is associated with an increased risk of mortality in these patients
25288608 the existence of a TRPV1-LI innervation in human scalp arteries and provides the first quantitative assessment of the TRPV1, CGRP and subance P innervation of those vessels
25283849 NGAL and procalcitonin may be potential biomarkers for preeclampsia. Their levels increase significantly in preeclampsia and they are related to the severity of the disease.
25218831 Data indicate that high procalcitonin (PCT) value at diagnosis is an independent predictive factor of bad prognosis.
25194863 Procalcitonin was upregulated in acute heart failure and was an indication of inflammation and immune activation.
25159654 Both CRP and procalcitonin were significantly higher in patients with postoperative fistula or abscess after sleeve gastrectomy.
25152987 The use of an ultra-sensitive procalcitonin assay identifies patients with cirrhosis at very low risk of bacterial infections.
25135735 The results showed that the expression of SP and CGRP was significantly enhanced in the neurogenic SMSCs in response to IL-1beta, IL-6 and TNF-alpha, and the effect was remarkably inhibited by HA.
25132401 High procalcitonin levels in dyspeptic patients are associated with CagA-positive Helicobacter pylori.
25055485 Procalcitonin (PCT) level in blood plasma of patients with bacteremia is higher than in patients with negative blood cultures; Gram-negative infection is more likely in cases when PCT higher than 2.47 ng per ml
25035980 CGRP-induced cAMP/PKA activation suppresses activation of MAPK induced by TGFbeta1
25034373 Data indicate that serum procalcitonin is a predictor of short-term mortality and thus may allow the identification of septic patients at increased mortality risk, and help improve their treatment.
25015815 In this review, the influence of the CGRP family peptides in reproduction and pregnancy is explored and discussed.
24991721 Data indicate that procalcitonin and C-reactive protein (PCT/CRP) ratio was the best marker for discrimination between tumor fever and infection.
24943060 Maternal serum CGRP and PTHrP concentrations were positively correlated with the infant's birth weights.
24908181 CGRP was significantly increased in hypertrophic scars compared with control. In reticular dermis and papillary dermis, CGRP correlated significantly with pain and itching.
24877114 The serum CRP showed a marked increase on the 3rd postoperative day while the peak of serum PCT was earlier, even if much lower, on the first day.
24858965 our results confirm that procalcitonin is a reliable marker of post-traumatic inflammatory response and the prognosis of multitrauma patients.
24853718 the effect of CGRP on osteoblast in co-culture system with breast cancer
24685732 Serum procalcitonin concentration is a sensitive and promising predictor of high-grade vesicoureteral reflux in pyelonephritis.
24673487 Interictal CGRP and, to a lesser degree, VIP levels measured in peripheral blood are of great help in predicting response of chronic migraine patients to Onabotulinumtoxin type A
24672147 sTREM-1 and procalcitonin have roles in sepsis and may predict sepsis mortality
24640865 The study evaluated if procalcitonin (PCT) in community-acquired pneumonia provides prognostic information with the Pneumonia Severity Index and CURB-65 in sickle cell adult patients.
24612487 In critically ill patients with pneumonia during the influenza season, procalcitonin is an accurate marker for detection of bacterial pneumonia.
24522762 Procalcitonin of 0.2 ng/mL or greater was demonstrated to be very specific for sepsis among patients with aneurysmal subarachnoid hemorrhage.
24440185 Low procalcitonin levels may be useful in the diagnosis of postimplantation syndrome after endovascular aortic repair.
24439927 In burn patients, there were no statistically significant differences in the procalcitonin (PCT) figures between the cases with confirmed and unconfirmed infection. PCT values showed no value for differentiating patients with SIRS from those with sepsis.
24393388 Complicated heart failure elevates the procalcitonin level in patients with bacterial infection.
24379064 Serum procalcitonin is significantly higher in community acquired pneumonia compared to tuberculosis.
24363525 Serum procalcitonin levels were significantly correlated with ulcerative colitis activity.
24349237 Serum PCT is superior to CRP, IL-6, and SAA for predicting the development of acute kidney injury and prognosis in acute pancreatitis.
24320627 Data suggest that up-regulation of plasma procalcitonin levels occurs early in intra-amniotic infection/chorioamnionitis and may serve as biological marker predictive of preterm premature rupture of membranes.
24315546 An increase in PCT levels does not help to predict surgical complications in critically ill surgical patients.
24254894 When the patients with overt and nonovert DIC were compared, the PrC level was lower, and PCT, PAI-1, IL-6, and IL-10 levels were higher in the patients with overt DIC.
24140435 CGRP causes long-lasting non-selective arterial smooth muscle relaxation that may add to the neuropeptide being a physiological antagonist of arterial effects of ET-1.
24135723 the DNA methylation pattern of the promoter region of the CALCA gene varies in different types of bacterial preterm sepsis, thus suggesting a potential use as an epigenetic biomarker.
24125506 Ala-5 and Thr-6 are key determinants of agonist activity for CGRP
24120103 The highest levels of procalcitonin (PCT) were found in patients with bacteremia caused by Streptococcus pneumoniae serotypes 7F, 19A, 3 & 1. PCT levels were able to predict bacteremia (caused by S. pneumoniae or not) in patients with pneumonia.
24081951 CGRP acts via its receptor expressed by Langerhans cell (LC) and interferes with multiple steps of LC-mediated HIV-1 transmission.
24065474 High CALC1 expression is associated with distant metastases in colorectal cancer
24012914 Studied sTREM-1, procalcitonin and C-reactive protein in postmortem serum in a series of sepsis-related fatalities and control individuals who underwent medico-legal investigations.
23975872 Increased CGRP level measured in peripheral blood outside migraine attacks and in the absence of symptomatic medication could be a biomarker helping to diagnose chronic migraine.
23968948 This study did not show any association between CALCA T-692C gene polymorphism and migraine.
23835994 suPAR and the non-specific inflammatory markers CRP and PCT may have roles in development of community acquired pneumonia in children
23813138 C-reactive protein and procalcitonin were reliable markers of bacterial infection in subjects admitted due to complications of liver cirrhosis.
23799041 There is a decreased expression of CRISPLD2 in septic shock and it is association with procalcitonin in sepsis.
23787145 In septic patients, procalcitonin kinetics over the first 72 hours provide prognostic information beyond that available from clinical risk scores.
23731651 CCL17-induced, CCR4-dependent release of CGRP by human airway epithelial cells represents a novel inflammatory pathway in patients with asthma and allergic disease.
23722301 Increased PCT levels in abdominal exudate may predict PPOI in the early period following colorectal surgery.
23708553 the BMP pathway is involved in calcitonin gene-related peptide-induced osteogenic differentiation but not in proliferation, whereas the cAMP/pCREB pathway is involved in the expression of BMP-2.
23702052 In patients with acute pyelonephritis, divided into 4 groups on the basis of systemic inflammatory response syndrome, organ dysfunction, and persistent hypotension, the procalcitonin level was higher in the septic shock group compared with other groups.
23682226 BISAP (bedside index of severity in acute pancreatitis) is more accurate for predicting the severity of acute pancreatitis than serum procalcitonin.
23682219 Procalcitonin marker improves the diagnosis of bacterial infections and guides antibiotic therapy [review]
23580106 An increase in 25(OH)D after normalization of blood glucose, and a decrease in PCT in patients with hyperglycemia, is reported.
23575548 In conclusion, G-706T and C-778T polymorphisms in the CT gene are significantly associated with the development of primary osteoarthritis of the knee.
23552643 Amyloid fibril formation rates of human CT were significantly reduced when aromatic residues (Tyr12, Phe16 and Phe19) were replaced with Leu residues.
23519568 This study showed that implicating procalcitonin as an adjunctive biomarker along with the MASCC score could improve the risk stratification of patients with chemotherapy-induced febrile neutropenia.
23510625 The aim of this study was to evaluate diagnostic value of soluble biomarkers (CD14 subtype, interleukin-2 receptor, HLA-G) and procalcitonin in the identification of infectious process at the beginning of a febrile episode in pediatric oncology patients.
23490535 Expression and distribution of phosphodiesterase (PDE) type 1, known to hydrolyze both cyclic AMP and cyclic GMP, are evaluated in relation to CGRP; all are involved in control of vaginal blood flow.
23461295 It is concluded that CGRP is a strong proangiogenic growth factor, thereby contributing to bone development and remodeling by promoting angiogenesis.
23436675 Procalcitonin normalization during antibiotic therapy suggests a good response to infection possibly leading to less infection-related deaths.
23356193 Maternal circulating level of CGRP is lowered in pregnant women with hypertension or pre-eclampsia.
23327335 Data suggest that serum calcitonin level in hypercalcitoninemic range may be suggestive of medullary thyroid carcinoma in subjects with thyroid nodules being evaluated for chronic autoimmune/Hashimoto's thyroiditis and/or papillary thyroid cancer.
23313519 The significantly increased levels of the CGRP during the first days after onset of the subarachnoid hemorrhage in the non-vasospasm group indicate a potential protective role
23237777 No significant association of the tested SNPs of the CALCA gene were found with migraine susceptibility.
23214280 Procalcitonin measurement could be an alternative to calcitonin measurement for evaluation of medullary thyroid cancer status.
23128457 procalcitonin has a better association with bacterial sepsis and is superior to currently available biomarkers in the clinical setting.
23123709 It regulates immunological reactions of skin and skin inflammations.(review)
23118979 serum markers as prodictors of infection after stroke
23086568 Serum procalcitonin (ProCT), admission diagnoses, and chest radiographic findings are used to derive receiver operating characteristics curves to assess predictive accuracy of ProCT for the presence of infiltrates.
23010746 Levels of CGRP protein and mRNA expression in the colonic mucosa of patients are closely associated with ulcerative colitis severity and corroborate traditional indices used to assess the disease.
22961239 Expression of esophageal epithelial CGRP and substance P is increased, and correlates negatively with perception thresholds in non-erosive reflux disease.
22960196 Glucose-dependent insulinotropic peptide has no effect on the expression of calcitonin peptides in the subcutaneous adipose tissue of moderately obese humans.
22898635 increased intra-abdominal pressure (IAP) was accompanied by increased procalcitonin (PCT) serum concentration in patients with acute pancreatitis(AP) thus PCT and IAP can both be used as early markers of AP severity
22819536 cycle. These results indicate that 5HT enhances capsaicin-evoked CGRP release from human trigeminal nociceptors in a sexually dimorphic manner providing a mechanistic basis for prevalence of trigeminal pain disorders in women.
22685586 Data indicate that plasma exchange reduced plasma levels of the examined biomarkers: 23% for NT-proBNP, 64% for CRP, 31% for procalcitonin and about 14%for troponin T.
22677443 Neural controls of human hair growth show that calcitonin gene-related peptide (CGRP) induces catagen
22652631 serum procalcitonin may be a better marker to rule out bacterial infection in lupus flare but not in remission or general screening
22631226 When treated with CGRP, osteocalcin and alkaline phosphatase mRNA and mineralization nodus numbers were increased in an osteoblast and endothelial cell co-culture system.
22607374 Data show that patients with procalcitonin concentrations above decisional thresholds had higher C-reactive protein concentrations and lower glomerular filtration rate (eGFR).
22573121 Using a human model opposite to hypertension, this study provides information on the relationships between CGRP, heme oxygenase-1, FMD, major clinical and biochemical factors involved in cardiovascular disease, and EPC-specific populations
22561677 Procalcitonin has emerged as the most specific biomarker for bacterial infection
22550867 The expression of calcitonin gene related peptide was identified in pineal gland and thymus, but it did not change with age.
22429353 CGRP and SP may have a role in the pathogenesis of coronary artery disease in patients with diabetes.
22399852 Procalcitonin is useful in COPD patients for alerting clinicians to invasive bacterial infections such as pneumonia but it does not distinguish bacterial from viral and noninfectious causes of acute exacerbations.
22371911 Procalcitonin concentrations determined within the first 48 hours after burn injury can be a useful prognostic indicator for sepsis and mortality in burn patients.
22233274 Data suggest that CGRP plays role of an angiogenic protein in synovitis; blocking CGRP/CGRP receptor signal transduction could provide molecular targeted therapy for synovitis in rheumatoid arthritis or osteoarthritis.
22208649 This study demonistrated thta CGRP immunoreactive fibers were frequently found intraganglionic in the SPG in the vicinity of neurons.
22207498 levels significantly higher in those patients with pneumococcal pneumonia than in patients with other bacterial pneumonias
22200484 Calcitonin undergoes a conformational transition from an extended to a beta-hairpin structure in the process of molecular association.
22149667 Procalcitonin levels were both an unadjusted and an adjusted predictor (corrected for diagnosis and Troponin I) of Intensive Cardiac Care Unit mortality and of 1-year follow-up major cardiovascular events and total mortality.
22079264 Comparative levels of macrophage migration inhibitory factor, procalcitonin, osteoprotegerin, interleukin-8, hs-C reactive protein, D-dimer in febrile neutropenia, newly diagnosed cancer patients, and infectious fever.
22074408 This study demonstrates the detailed expression of CGRP and its receptor components within spinal trigeminal nucleus in the brainstem and in the spinal cord at C1-level
22019953 analysis of the role of procalcitonin (Pro-CT) and/or C-reactive protein (CRP) in fever
21996233 The mold colonization of transplanted lung is a frequent complication and should be considered even in the case of proper prophylaxis. Procalcitonin might be the marker helpful in mold infection diagnosis.
21937947 Significant decrease in PCT concentration, rather than PCT concentration itself, may be a useful indicator of survival in septic shock patients when PCT concentration is greater than 10 ng/mL.
21843355 In a calvarial osteolysis model, the eroded skull surface of calcitonin (CT)-deficient mice with particle implantation is reduced by 20.6% after substitution with human CT.
21778801 Serum procalcitonin was a promising simple biomarker and had similar accuracy of APACHE-II scores as predicting severity of acute pancreatitis.
21703310 Extracellular loops 1 and 3 and their associated transmembrane regions of the calcitonin receptor-like receptor are needed for CGRP receptor function.
21658317 Procalcitonin cannot be considered as a good marker of joint prosthesis infection.
21550738 elevated MMP-9, reduced SP, and normal CGRP levels were characteristic of the blood biomarker profiles of alternating hemiplegia of childhood patients
21541027 While procalcitonin is not useful for diagnosis of infection at onset of neutropenic fever, it may help to distinguish a minority of potentially severe infections.
21457239 The majority of familial hemiplegic migraine patients with and without known mutation display no sensitivity to CGRP signaling compared to common types of migraine.
21423046 CALCA gene methylation pattern is an independent prognostic factor in pediatric acute leukemia that could characterize a group of patients with enhanced risk of relapse and death
21391919 CGRP transiently induces NO production in osteoblasts by elevating intracellular Ca2+ to stimulate the activity of endothelia NOS in vitro.
21352816 Calcitonin gene related peptide expression is reduced following nuclear factor-kappaB inhibition in sciatic nerve injury.
21289592 More CGRP-immunoreactive sensory nerve fibers and dorsal root ganglia neurons are found innervating muscle in the midline approach area than in the Wiltse paraspinal approach area.
21219690 In West African pulmonary tuberculosis patients, PCT levels were low but increased significantly with increasing severity of disease, and can predict mortality risk.
21216873 Epigenetic modulation is sufficient to induce the CGRP gene in glia
21211657 calcitonin gene-related peptide and vascular endothelial growth factor...might play a role in the erythema and edema characteristic of allergic inflammation
21195698 The results of this study showed no significant association between the intronic 16bp deletion in the CALCA gene and migraine in the tested Australian Caucasian population
21083886 Procalcitonin levels accurately predict the presence of bacteremia and bacterial load in patients with febrile urinary tract infections.
21078153 A substantial decrease in serum procalcitonin precursor level is predictive of survival in patients with severe sepsis.
20959432 Our data support the hypothesis of an interaction between BDNF and CGRP in migraine susceptibility
20959432 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20930646 Determination of procalcitonin and CRP, in the pleural fluid and blood, does not seem to provide great value to the diagnosis of parapneumonic pleural effusions.
20929576 In comparison with postoperative controls, critically ill patients with sepsis show an increase in lysis index and procalcitonin levels.
20890583 Studies revealed that elevated procalcitonin (PCT) levels in human blood could be detected in cases of sepsis and bacterial infection.
20832068 CGRP can counteract Ang II-induced EPCs senescence through down-regulating the expression of NADPH oxidase and reactive oxygen species production and increasing the production of klotho
20805714 Serum procalcitonin level was a better marker than C-reactive protein level or erythrocyte sedimentation rate for the diagnosis of lobar pneumonia in children with community-acquired pneumonia.
20803037 in febrile neutropenia during chemotherapy-induced gastrointestinal mucositis, median IL-8 and procalcitonin levels were significantly increased in patients with bacterial infection
20699253 serum PCT level may be valuable for differentiating PE patients with or without fever from patients with CAP.
20654748 Observational study of gene-disease association. (HuGE Navigator)
20654671 Data suggest that CGRP can stimulate epidermal stem cells to detach from their niche, break quiescence, and undergo division; beta-catenin and c-myc may functionally be involved in the process.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595156 Initial procalcitonin levels provide only moderate prognostic information concerning mortality risk and did not improve clinical risk scores. However, procalcitonin was helpfulfor prediction of adverse events.
20530033 Serum procalcitonin is not habitually elevated in HIV-negative pulmonary tuberculosis patients and is a useful biomarker for discriminating between pulmonary tuberculosis and community-acquired pneumonia.
20441469 Results show that solid carcinomas "per se" did not increase circulating procalcitonin concentrations, regardless of the histotype and stage of the disease.
20375903 CGRP may work as an endogenous protective substance to counteract endothelial progenitor cell senescence in hypertension
20233513 Higher procalcitonin levels within 48 h post-admission may reflect an inflammatory state that is associated with increased early and 6-month mortality in acute coronary syndrome.
20214413 Procalcitonin is a Prognostic marker for acute myocardial infarction
20173430 Observational study of gene-disease association. (HuGE Navigator)
20146986 Procalcitonin only showed moderate predictive value for sepsis-related mortality.
20146868 These data support the view that PCT levels may be a better indicator than CRP levels in the early diagnosis of septic complications in patients with multiple trauma.
20143189 IDC + DCIS is an entity that is more aggressive, ER independent, and possibly associated with a pathway linked to stromal involvement and CGRP activity.
20131075 Data show that procalcitonin is better than C-reactive protein for diagnosing sepsis and septic shock, mainly at admission, and is related to disease severity.
20046084 Procalcitonin seems to be reliable for sepsis diagnosis, and may provide useful information for the critically ill patients.
20010500 The number of human pancreatic islet cells expressing CGRP, GABA and GAD decreased significantly after the onset of Type 2 diabetes
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909213 Our results have demonstrated, for the first time, a positive impact for Substance P and CGRP as expansion factors for the growth of cord blood CD34+ hematopoietic stem cells.
19829249 The observed spatial and temporal regeneration of CGRP-positive nerve fibers in ectopic bone formation suggested CGRP innervation is associated with ectopic osteogenesis.
19797133 procalcitonin is downregulated with successful antibiotic therapy in ventilator-associated pneumonia
19736013 The dinucleotide calcitonin polymorphism in the calcitonin gene may become a useful marker for genetic studies of osteoarthritis of the knee in Mexican population.
19736013 Observational study of gene-disease association. (HuGE Navigator)
19715516 Serum levels of high-sensitivity C-reactive protein and procalcitonin are biomarkers for transplantrelated complications such as graft-versus-host disease or infection.
19685709 There was no statistical significance between the CGRP levels of the nasal septum in the perennial allergic rhinitis patients and the normal controls.
19623026 Risk factor for graft failure after kidney transplantation, may be of use as an early biomarker.
19589278 For early detection of postoperative infectious complications after gynaecological surgery, procalcitonin levels > 2 ng/ml are more specific than C-reactive protein.
19543500 study shows that the pleural fluid procalcitonin levels in bacterial parapneumonic effusion are significantly different from those of the non-bacterial and control groups.
19541585 Genotype distribution with prognosis of the hip arthroplasty showed neither an association with clinical characteristics of the patients nor the implantation technique.
19541585 Observational study of gene-disease association. (HuGE Navigator)
19541012 Serum measurements of procalcitonin may be valuable in predicting the severity of acute pancreatitis and the risk of developing infected pancreatic necrosis.
19485922 This review focuses on the effects of CGRP on skeletal muscle excitation-contraction coupling, as well as the corresponding pathophysiological consequences.
19484659 Patients on hemodialysis by high-flux membranes, but not by low-flux membranes, displayed mean PCT values significantly decreased after dialysis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19447044 CALCA polymorphisms are unlikely to influence clinical outcome in polytraumatized patients.
19440016 Serum CGRP levels were significantly elevated in the prostate cancer patients with high grade or high stage. In patients receiving hormonal therapy various clinical factors influence the CGRP levels.
19299090 Calcitonin (CT), a peptide hormone secreted in response to hypercalcemia, has the dual effect of inhibiting osteoclast recruitment as well as their resorptive activity.
19282810 Study demonstrates that there is not sufficient evidence to recommend procalcitonin measurement as a predictor for perioperative neurological deficit during carotid endarterectomy.
19236383 Plasma CGRP is useful for diagnosis in paediatric migraine.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19078972 Serum C-reactive protein, Procalcitonin and amyloid A levels were found to be elevated in premature infants with neonatal sepsis
18959118 Observational study of gene-disease association. (HuGE Navigator)
18953261 Assessment of the prognostic value of procalcitonin in the prognosis of acute pancreatitis.
18941191 Exposure to CGRP significantly enhances the IL-4 response of transgenic T cells. In contrast, exposure of purified Langerhans cells to CGRP diminishes the interferon-gamma response.
18784182 Elevated calcitonin is associated with metastasis of prostate cancer.
18779512 Familial hemiplegic migraine patients do not show hypersensitivity of the calcitonin gene-related peptide (CGRP)-cyclic adenosine 3',5'-monophosphate pathway, as characteristically seen in migraine patients without aura.
18626012 identified an antigen recognized on a human non-small-cell lung carcinoma by a cytotoxic T lymphocyte clone derived from autologous tumor-infiltrating lymphocytes. The antigenic peptide is presented by HLA-A2 and is encoded by the CALCA gene
18603306 CGRP displays antimicrobial activity against S. mutans, L. acidophilus, E. faecalis, E. coli, P. aeruginosa, and C. albicans.
18574663 patients with severe sepsis had significantly higher procalcitonin levels than those with sepsis
18556380 Although serum PCT (procalcitonin)is elevated in some patients at the time of peritonitis, its value in making a diagnosis and predicting long-term prognosis remains doubtful.
18525431 there is no association between the activity of systemic lupus erythematosus (SLE) and procalcitonin levels
18403669 Serum levels of procalcitonin may be a useful marker to predict which patients subsequently have early ventilator-associated pneumonia.
18384419 We conclude that there is no change in the microvascular responsiveness of the subcutaneous microvasculature in migraine.
18295515 Serum procalcitonin is a non-invasive test that has a high negative predictive vale in ruling out colon ischemia after aortic surgery.
18211417 Significantly higher CGRP concentration was observed in atopic dermatitis patients suffering from severe pruritus.
18197882 Specific changes in CGRP and substance P at different levels of the central nervous system in the different models of pain (formalin test and nitroglycerin administration).
18180663 serum procalcitonin level is a valuable marker of sepsis severity
18167349 USF1 and USF2 are important contributors to neuronal-specific and mitogen-activated protein kinase regulation of the CGRP gene in trigeminal ganglion neurons
17941085 These data show that ADM acts as a survival factor in osteoblastic cells via a CGRP1 receptor-MEK-ERK pathway, which provides further understanding on the physiological function of ADM in osteoblasts.
17934713 Data show that serum procalcitonin might be of value for distinguishing between infected and non-infected foot ulcers in subgroups of diabetic patients.
17785463 Functional calcitonin gene-related peptide receptors are formed by the asymmetric assembly of a calcitonin receptor-like receptor homo-oligomer and a monomer of RAMP1.
17710246 Data show that maternal plasma procalcitonin concentrations are elevated, both in patients with preterm and term preterm premature rupture of membranes in comparison to healthy pregnants.
17676478 Procalcitonin measurement is a helpful marker in bacterial infection and sepsis.
17669797 Procalcitonin levels are increased in the postoperative course after major pulmonary resection. Cardiac and infectious complications are associated with higher levels and a slower decrease.
17558349 Results show that procalcitonin and sTREM-1 are not specific for infection and can increase markedly in acute inflammation without infection.
17552872 Different types of ileus induce elevations in plasma procalcitonin levels.
17535749 Observational study of gene-disease association. (HuGE Navigator)
17535749 the cytosine-adenine repeat at the calcitonin gene locus may be one of the genetic factors that regulate serum osteocalcin levels in Japanese women
17485015 Observational study of gene-disease association. (HuGE Navigator)
17485015 A novel 2-bp microdeletion polymorphism was discovered in the CALCA gene; the CALCA gene could be the susceptibility gene foressential hypertension.
17481780 JNK-AP-1 pathway involved in IL-1beta-induced CGRP secretion in human type II alveolar epithelial cells.
17441790 Calcitonin gene-related peptide, a potent vasodilator, is markedly up-regulated in the airways of atopic asthmatics during late-phase reactions provoked by inhalation of allergen-derived T-cell peptides.
17381353 Calcitonin blood levels do not decrease with weaning in chronic alcoholism
17267696 CALCA induces in vitro angiogenesis by stimulating endothelial cell proliferation, migration, and capillarylike tube formation
17251226 Calcitonin gene-related peptide in bronchoalveolar lavage relates to cough sensitivity and is likely to be important in the pathophysiology of chronic cough
17149558 NT-proBNP levels correlate with PCT and CRP levels in septic patients.
17123735 The data suggest that SP, CGRP, and ACE are relevant to migraine pathophysiology, and that they may interact.
17101796 These results define a critical role for Fox-1 and Fox-2 proteins in exon 4 inclusion of calcitonin/CGRP pre-mRNA and establish a regulatory network that controls the fate of exon 4.
17087112 SP, CGRP and VIP may play important roles in the pathophysiological mechanism of vasomotor rhinitis.
17038199 A review of the literature describes the evolution of serum procalcitonin levels after uncomplicated cardiac surgery and as a tool in discriminating bacterial and fungal infections.
17026622 Observational study of gene-disease association. (HuGE Navigator)
17026622 allele A and genotype AA frequencies were significantly higher in osteoporotic women than in non-osteoporotic women
16996466 May play potential roles in maternal hemodynamic adaptation and fetal growth. Decreased circulating CGRP may be involved in maternal-fetal pathophysiology of pre-eclampsia. Placenta villi might be one of the potential sources of CGRP during pregnancy.
16890288 The CALCA was methylated in 85.7% (18/21) of the analyzed samples in pediatric myelodysplastic syndrome (MDS).
16840549 DREAM plays an important role in human calcitonin gene expression in a Ca(2+)- and cAMP-dependent manner
16720289 human calcitonin at low local pH could be involved in osteoclasts' calcium-sensitive permeability through channel formation and/or receptor interaction
16712930 The hypermethylation of Calcitonin(CALCA) promoter is a promising prognostic marker and may predict a higher risk for acute lymphoblastic leukemia(ALL)patients with CNS infiltration.
16710309 CGRP may act to regulate keratinocyte biology through intracellular nitric oxide by modulation of S-nitrosothiol stores and stimulation of NO synthase activity
16611736 results show that the cAMP/PKA pathway is involved in the CGRP inhibition of osteoprotegerin mRNA and protein secretion in osteoblast-like cells and that this effect favors osteoclastogenesis
16597919 findings show that in type II alveolar cells intrinsic and extrinsic peptide CGRP inhibits IL-1-induced MCP-1 secretion in an autocrine/paracrine mode
16574742 Expression of hCT in primary Prostate Cancers increase with tumor grade, suggesting an important role for hCT in the progression to a metastatic phenotype.
16511394 Serum procalcitonin (Pct)concentrations exceeded normal values in all children with invasive bacterial infection, was low in viral infection and toxic liver injury, and moderately elevated in 50% of children with an autoimmune process
16439457 progesterone receptor, calcitonin, and tissue tranglutaminase are involved in a signaling pathway in Ishikawa endometrial cells
16386179 Serum procalcitonin levels in patients with multiple organ dysfunction syndrome were higher in the infection group than in the non-infection group.
16236878 Procalcitonin may have a role to predict the microbial etiology in patients with community acquired pneumonia.
15880427 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15880427 Strong positive association of the CALCA C allele with the risk of ovarian cancer among Japanese
15784626 post-receptor signaling of calcitonin gene-related peptide (CGRP) is through protein kinase c epsilon-dependent expression of heat shock protein 70 (HSP70)
15761654 Prresence in pituitary tumours is unknown but does not appear to be related to headache or endocrine activity of the tumour.
15761041 CGRP and ADM are two differentially regulated novel adipose tissue secretion factors exerting autocrine/paracrine roles.
15696922 Circulating NO and CGRP are suppressed in obstructive sleep apnea and hypopnea syndrome. The content of NO in pharyngeal tissues increases significantly and that of CGRP decreases markedly.
15621724 calcitonin is expressed in diverse tissues and has roles in cell differentiation and tissue morphogenesis [review]
15449935 Two structural models of human calcitonin(9-32) carrier peptide are consistent with the data: (i) a linear backbone conformation of hCT(9-32) and (ii) an antiparallel beta-sheet structure.
15319367 results suggest that type II alveolar epithelial cells-derived CGRP may act in an autocrine/paracrine mode and play an important inhibitory role in the local area in lung inflammatory diseases
15300632 Data suggested that CGRP may play a functional role in compensating the chronic heart failure in human.
15168342 Octreotide augments the amount of CGRP in cultured thyroid tumor cells and increases the amount of CGRP in the culture media.
14984255 Selected human calcitonin-derived peptides have cell penetrating properties on Madin-Darby canine kidney cell monolayers. The uptake mechanism seems to involve an endocytic pathway.
14745805 Assessing interatomic distances between amide nitrogen and carbonyl carbon of neighboring chains of calcitonin peptides.
14684361 CGRP may play role in control of human fetoplacental vascular tone, and vascular dilations in response to CGRP may involve activation of KATP channels, cAMP, and nitric oxide pathway.
14654229 that CGRP antagonizes oxidative stress-induced apoptosis by up-regulating MAP kinase activation and that activation of these kinases was necessary to protection.
14627864 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14586070 Expressed in a significant proportion of hyperplastic and neoplastic parathyroid glands.
12917321 results report the identification of TIAR as a novel player in the regulation of calcitonin/CGRP alternative RNA processing
12871824 This review points out a distinct role for full-length peptide CGRP by inhibiting background noise in the activity-dependent modulation of cholinergic neurotransmission.
12728303 Elevation of procalcitonin began immediately after graft reperfusion, and levels at postoperative day 2 were significantly higher in the case of postoperative complications.
12594852 Intramuscular transfer of naked calcitonin gene-related peptide gene prevents autoimmune diabetes induced by multiple low-dose streptozotocin in C57BL mice
12540523 Arg11 and Arg18 are involved in specific electrostatic interactions with other residues, either on CGRP1 receptors or elsewhere on CGRP(8-37); Leu16 is in a conformationally restricted site when CGRP8-37 binds to CGRP1 receptors, unlike Leu12 and Leu15.
12529288 Responses to CGRP and ADM are mediated by CGRP(8-37)-sensitive receptors and that the endothelial ADM receptor induces vasodilation by a nitric oxide-guanylyl cyclase mechanism, whereas a smooth muscle CGRP receptor signals by a cAMP-dependent mechanism
12446725 forms fibril formation as studied by high resolution solid state 13C NMR; effect of electrostatics
12369791 Katacalcin regulates human CD14+ PBMC migration via signaling events involving protein kinase A-dependent cAMP pathways.[katacalcin]
12220731 Release of this peptide into the blood is affected by exercise and altitude.
12213903 expression at the human implantation site
12198603 milk procalcitonin might contribute to the activation of the developing neonatal immune system
11317366 Observational study of gene-disease association. (HuGE Navigator)
11185743 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQ      1 - 70
EREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA                 71 - 128
//

Text Mined References (344)

PMID Year Title
27096761 2016 Prospective Evaluation of Procalcitonin, Soluble Triggering Receptor Expressed on Myeloid Cells-1 and C-Reactive Protein in Febrile Patients with Autoimmune Diseases.
27012052 2016 Procalcitonin--a Marker for Anastomotic Insufficiency after Pancreatoduodenectomy?
26986140 2016 Diagnostic Accuracy of Procalcitonin in Bacterial Meningitis Versus Nonbacterial Meningitis: A Systematic Review and Meta-Analysis.
26666342 2016 Procalcitonin-based indication of bacterial infection identifies high risk acute heart failure patients.
26636517 2015 Clinical significance of serum procalcitonin level monitoring on early diagnosis of severe pneumonia on children.
26596282 2016 Effect of calcium ions on human calcitonin. Possible implications for bone resorption by osteoclasts.
26495299 2015 Comparison between procalcitonin, brain natriuretic peptide, and uric acid in children with cardiomyopathy and controls.
26482503 2016 miR-125b regulates procalcitonin production in monocytes by targeting Stat3.
26481456 2016 Use of fine-needle aspirate calcitonin to detect medullary thyroid carcinoma: A systematic review.
26271020 2015 Adrenomedullin--A New Marker in Febrile Neutropenia: Comparison With CRP and Procalcitonin.
26191294 2015 CGRP 4218T/C polymorphism correlated with postoperative analgesic effect of fentanyl.
26188130 2015 The role of serum procalcitonin in the diagnosis of bacterial meningitis in adults: a systematic review and meta-analysis.
26046926 2015 Sepsis biomarkers in neutropaenic systemic inflammatory response syndrome patients on standard care wards.
26018813 2015 Measurement of C-reactive protein, procalcitonin and neutrophil elastase in saliva of COPD patients and healthy controls: correlation to self-reported wellbeing parameters.
25997247 2015 The role of CGRP and CALCA T-692C single-nucleotide polymorphism in psoriasis vulgaris.
25992537 2015 Procalcitonin is a marker of gram-negative bacteremia in patients with sepsis.
25975456 2015 Maternal serum copeptin, MR-proANP and procalcitonin levels at 11-13 weeks gestation in the prediction of preeclampsia.
25963492 2015 Evaluation of procalcitonin, C-reactive protein, interleukin-6 & serum amyloid A as diagnostic biomarkers of bacterial infection in febrile patients.
25926728 2015 Procalcitonin and C-reactive protein cannot differentiate bacterial or viral infection in COPD exacerbation requiring emergency department visits.
25923821 2015 Calcitonin gene-related peptide in the joint: contributions to pain and inflammation.
25872263 2014 [The concentration of procalcitonin in blood andi enteric exudation in patients at early post-operation period].
25750561 2015 Cutoff value of serum procalcitonin as a diagnostic biomarker of infection in end-stage renal disease patients.
25697203 2014 [Use of procalcitonin as diagnostic marker in acute gastroenteritis].
25691533 2015 Plasma concentrations of copeptin, C-reactive protein and procalcitonin are positively correlated with APACHE II scores in patients with sepsis.
25638513 2015 Early monitoring of ventriculostomy-related infections with procalcitonin in patients with ventricular drains.
25578529 2015 Increasing expression of substance P and calcitonin gene-related peptide in synovial tissue and fluid contribute to the progress of arthritis in developmental dysplasia of the hip.
25578228 2015 Comparing the prognostic performance of ASSIST to interleukin-6 and procalcitonin in patients with severe sepsis or septic shock.
25575698 2015 Procalcitonin in the assessment of bacteraemia in emergency department patients: results of a large retrospective study.
25469944 2015 Serum procalcitonin as a diagnostic aid in patients with acute bacterial septic arthritis.
25445228 2015 The diagnostic value of cerebrospinal fluids procalcitonin and lactate for the differential diagnosis of post-neurosurgical bacterial meningitis and aseptic meningitis.
25436308 High levels of procalcitonin in the early phase after pediatric liver transplantation indicate poor postoperative outcome.
25370803 2015 Relationship between procalcitonin serum levels and functional outcome in stroke patients.
25319789 2015 Host response biomarkers in sepsis: the role of procalcitonin.
25319702 2014 Multimodal use of calcitonin gene-related peptide and substance P in itch and acute pain uncovered by the elimination of vesicular glutamate transporter 2 from transient receptor potential cation channel subfamily V member 1 neurons.
25298068 2014 Value of serum procalcitonin and interleukin-6 in patients with bullous impetigo and staphylococcal scalded skin syndrome.
25293477 Serum procalcitonin is a sensitive marker for septic shock and mortality in secondary peritonitis.
25288608 2015 TRPV1, CGRP and SP in scalp arteries of patients suffering from chronic migraine.
25283849 2015 Relationship of neutrophil gelatinase-associated lipocalin (NGAL) and procalcitonin levels with the presence and severity of the preeclampsia.
25218831 2014 Diagnostic and prognostic value of serum procalcitonin concentrations in primary lung cancers.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25194863 2014 Determinants of procalcitonin concentration in acute heart failure.
25159654 2015 C-Reactive protein and procalcitonin for the early detection of postoperative complications after sleeve gastrectomy: preliminary study in 97 patients.
25152987 Ultra-sensitive procalcitonin may help rule out bacterial infections in patients with cirrhosis.
25135735 2014 Mutual effect between neuropeptides and inflammatory cytokines in neurogenic SMSCs of human temporomandibular joint.
25132401 2015 Serum hsCRP and procalcitonin levels in dyspeptic patients infected with CagA-positive Helicobacter pylori.
25055485 [Procalcitonin as a predictor of bacteremia in postoperative cardiosurgery patients].
25035980 2014 Calcitonin gene-related peptide regulates mitogen-activated protein kinase pathway to decrease transforming growth factor ?1-induced hepatic plasminogen activator inhibitor-1 mRNA expression in HepG2 cells.
25034373 2014 Procalcitonin as a prognostic marker for sepsis: a prospective observational study.
25015815 2014 Calcitonin gene related family peptides: importance in normal placental and fetal development.
24991721 2015 Role of procalcitonin and C-reactive protein for discrimination between tumor fever and infection in patients with hematological diseases.
24943060 2014 Calcitonin gene- and parathyroid hormone-related peptides in normotensive and preeclamptic pregnancies: a nested case-control study.
24908181 2014 Immunohistochemical analysis of neuropeptides (protein gene product 9.5, substance P and calcitonin gene-related peptide) in hypertrophic burn scar with pain and itching.
24877114 2014 Serum C-reactive protein and procalcitonin kinetics in patients undergoing elective total hip arthroplasty.
24858965 Changes of procalcitonin level in multiple trauma patients.
24853718 2014 Calcitonin gene-related peptide inhibits osteolytic factors induced by osteoblast in co-culture system with breast cancer.
24685732 2014 Serum procalcitonin level for prediction of high-grade vesicoureteral reflux in urinary tract infection.
24673487 2014 CGRP and VIP levels as predictors of efficacy of Onabotulinumtoxin type A in chronic migraine.
24672147 2014 Serum soluble triggering receptor expressed on myeloid cells-1 and procalcitonin can reflect sepsis severity and predict prognosis: a prospective cohort study.
24640865 2013 Serum procalcitonin as a predicting value in severity and prognosis of CAP in sickle cell-patients.
24612487 2014 Procalcitonin for diagnosis of bacterial pneumonia in critically ill patients during 2009 H1N1 influenza pandemic: a prospective cohort study, systematic review and individual patient data meta-analysis.
24522762 2014 The utility of serum procalcitonin in distinguishing systemic inflammatory response syndrome from infection after aneurysmal subarachnoid hemorrhage.
24440185 2014 The role of procalcitonin in postimplantation syndrome after EVAR: a pilot study.
24439927 2014 Procalcitonin in the burn unit and the diagnosis of infection.
24393388 2014 Procalcitonin testing for diagnosis and short-term prognosis in bacterial infection complicated by congestive heart failure: a multicenter analysis of 4,698 cases.
24379064 2013 The diagnostic value of serum procalcitonin, IL-10 and C-reactive protein in community acquired pneumonia and tuberculosis.
24363525 2013 Clinical significance of serum procalcitonin in patients with ulcerative colitis.
24349237 2013 Procalcitonin levels predict acute kidney injury and prognosis in acute pancreatitis: a prospective study.
24320627 2014 Value of maternal procalcitonin levels for predicting subclinical intra-amniotic infection in preterm premature rupture of membranes.
24315546 2014 Procalcitonin in the recognition of complications in critically ill surgical patients.
24254894 2015 Dysregulation of inflammatory and hemostatic markers in sepsis and suspected disseminated intravascular coagulation.
24140435 2013 Long-lasting physiological antagonism of calcitonin gene-related peptide towards endothelin-1 in rat mesenteric arteries and human coronary arteries.
24135723 2013 DNA methylation pattern of CALCA in preterm neonates with bacterial sepsis as a putative epigenetic biomarker.
24125506 2014 Structure-activity relationships of the N-terminus of calcitonin gene-related peptide: key roles of alanine-5 and threonine-6 in receptor activation.
24120103 2014 [Ability of procalcitonin to predict bacteremia in patients with community acquired pneumonia].
24081951 2013 Calcitonin gene-related peptide inhibits Langerhans cell-mediated HIV-1 transmission.
24065474 Procalcitonin in patients with colorectal cancer.
24012914 2013 Value of sTREM-1, procalcitonin and CRP as laboratory parameters for postmortem diagnosis of sepsis.
23975872 2013 Interictal increase of CGRP levels in peripheral blood as a biomarker for chronic migraine.
23968948 2013 Calcitonin gene related peptide gene polymorphism in migraine patients.
23835994 2013 Soluble receptor for urokinase plasminogen activator in community-acquired pneumonia in children.
23813138 Acute phase proteins for the diagnosis of bacterial infection and prediction of mortality in acute complications of cirrhosis.
23799041 2013 CRISPLD2 is expressed at low levels during septic shock and is associated with procalcitonin.
23787145 2013 Procalcitonin decrease over 72 hours in US critical care units predicts fatal outcome in sepsis patients.
23731651 2013 CCL17/thymus and activation-regulated chemokine induces calcitonin gene-related peptide in human airway epithelial cells through CCR4.
23722301 2013 Procalcitonin in abdominal exudate to predict prolonged postoperative ileus following colorectal carcinoma surgery.
23708553 2013 Calcitonin gene-related peptide stimulates BMP-2 expression and the differentiation of human osteoblast-like cells in vitro.
23702052 2013 Serum procalcitonin level for the prediction of severity in women with acute pyelonephritis in the ED: value of procalcitonin in acute pyelonephritis.
23682226 2013 A comparison of the BISAP score and serum procalcitonin for predicting the severity of acute pancreatitis.
23682219 2013 Procalcitonin as a biomarker of infectious diseases.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23580106 2013 25-OH-Vitamin D and procalcitonin levels after correction of acute hyperglycemia.
23575548 2013 The association of single nucleotide polymorphisms in the calcitonin gene with primary osteoarthritis of the knee in Mexican mestizo population.
23552643 2013 Role of aromatic residues in amyloid fibril formation of human calcitonin by solid-state 13C NMR and molecular dynamics simulation.
23519568 2013 Adding procalcitonin to the MASCC risk-index score could improve risk stratification of patients with febrile neutropenia.
23510625 2013 The predictive value of soluble biomarkers (CD14 subtype, interleukin-2 receptor, human leucocyte antigen-G) and procalcitonin in the detection of bacteremia and sepsis in pediatric oncology patients with chemotherapy-induced febrile neutropenia.
23490535 2013 Phosphodiesterase type 1, calcitonin gene-related peptide and vasoactive intestinal polypeptide are involved in the control of human vaginal arterial vessels.
23461295 2013 The biological effects and mechanisms of calcitonin gene-related peptide on human endothelial cell.
23436675 2013 Procalcitonin variations after Emergency Department admission are highly predictive of hospital mortality in patients with acute infectious diseases.
23395606 2013 Identification of a novel 'aggregation-prone'/'amyloidogenic determinant' peptide in the sequence of the highly amyloidogenic human calcitonin.
23356193 Maternal plasma levels of endothelial dysfunction mediators including AM, CGRP, sICAM-1 and tHcy in pre-eclampsia.
23327335 2013 Influence of chronic autoimmune thyroiditis and papillary thyroid cancer on serum calcitonin levels.
23313519 2013 Calcitonin-gene related peptide and cerebral vasospasm.
23237777 2013 Association study of the calcitonin gene-related polypeptide-alpha (CALCA) and the receptor activity modifying 1 (RAMP1) genes with migraine.
23214280 Calcitonin and procalcitonin in patients with medullary thyroid cancer or bacterial infection.
23128457 2012 Associations between procalcitonin and markers of bacterial sepsis.
23123709 2012 [Regulatory mechanisms of calcitonin gene-related peptide (CGRP) in skin inflammation].
23118979 2012 Copeptin, procalcitonin and routine inflammatory markers-predictors of infection after stroke.
23086568 2013 Can serum procalcitonin levels help interpret indeterminate chest radiographs in patients hospitalized with acute respiratory illness?
23010746 2013 Calcitonin gene-related peptide is a promising marker in ulcerative colitis.
22961239 2013 High expression of calcitonin gene-related peptide and substance P in esophageal mucosa of patients with non-erosive reflux disease.
22960196 2012 In vivo effect of glucose-dependent insulinotropic peptide (GIP) on the gene expression of calcitonin peptides in human subcutaneous adipose tissue.
22898635 Correlation between procalcitonin and intra-abdominal pressure and their role in prediction of the severity of acute pancreatitis.
22819536 2012 Sex differences in serotonin enhancement of capsaicin-evoked calcitonin gene-related peptide release from human dental pulp.
22685586 2012 Therapeutic plasma exchange decreases levels of routinely used cardiac and inflammatory biomarkers.
22677443 2012 Neural controls of human hair growth: calcitonin gene-related peptide (CGRP) induces catagen.
22652631 2012 Serum procalcitonin has negative predictive value for bacterial infection in active systemic lupus erythematosus.
22631226 2012 Effect of calcitonin gene-related peptide on osteoblast differentiation in an osteoblast and endothelial cell co-culture system.
22607374 2012 Decisional procalcitonin thresholds are not adapted to elderly patients admitted to the emergency room.
22573121 2012 Calcitonin gene-related peptide, heme oxygenase-1, endothelial progenitor cells and nitric oxide-dependent vasodilation relationships in a human model of angiotensin II type-1 receptor antagonism.
22561677 2012 Procalcitonin and sepsis: recent data on diagnostic utility prognostic potential and therapeutic implications in critically ill patients.
22550867 2011 [Expression of AIF and CGRP markers in pineal gland and thymus during aging].
22429353 2012 Serum levels of calcitonin gene-related peptide and substance P are decreased in patients with diabetes mellitus and coronary artery disease.
22399852 2012 Utility of serum procalcitonin values in patients with acute exacerbations of chronic obstructive pulmonary disease: a cautionary note.
22371911 2012 Procalcitonin levels within 48 hours after burn injury as a prognostic factor.
22233274 2012 A role for the sensory neuropeptide calcitonin gene-related peptide in endothelial cell proliferation in vivo.
22208649 2012 Calcitonin gene-related peptide and its receptor components in the human sphenopalatine ganglion -- interaction with the sensory system.
22207498 2012 Diagnostic and prognostic value of procalcitonin in community-acquired pneumonia.
22200484 2012 NMR characterization of monomeric and oligomeric conformations of human calcitonin and its interaction with EGCG.
22149667 2012 The impact of admission procalcitonin on prognosis in acute coronary syndromes: a pilot study.
22079264 2012 Comparative levels of macrophage migration inhibitory factor, procalcitonin, osteoprotegerin, interleukin-8, hs-C reactive protein, D-dimer in febrile neutropenia, newly diagnosed cancer patients, and infectious fever.
22074408 2011 Calcitonin gene-related peptide (CGRP) and its receptor components in human and rat spinal trigeminal nucleus and spinal cord at C1-level.
22019953 2012 Procalcitonin and C-reactive protein levels as diagnostic tools in febrile patients admitted to a General Internal Medicine ward.
21996233 2011 Procalcitonin serum concentration in lung transplant recipients during mold colonization or infection.
21937947 2011 Dynamic change of procalcitonin, rather than concentration itself, is predictive of survival in septic shock patients when beyond 10 ng/mL.
21843355 2011 Calcitonin substitution in calcitonin deficiency reduces particle-induced osteolysis.
21778801 2011 Comparison of serum procalcitonin with Ranson, APACHE-II, Glasgow and Balthazar CT severity index scores in predicting severity of acute pancreatitis.
21703310 2011 Extracellular loops 1 and 3 and their associated transmembrane regions of the calcitonin receptor-like receptor are needed for CGRP receptor function.
21658317 Procalcitonin, C-reactive protein, interleukin-6, and soluble intercellular adhesion molecule-1 as markers of postoperative orthopaedic joint prosthesis infections.
21550738 2012 Profiles of blood biomarkers in alternating hemiplegia of childhood--increased MMP-9 and decreased substance P indicates its pathophysiology.
21541027 2011 Monitoring procalcitonin in febrile neutropenia: what is its utility for initial diagnosis of infection and reassessment in persistent fever?
21457239 2011 Calcitonin gene-related peptide does not cause migraine attacks in patients with familial hemiplegic migraine.
21423046 2011 Methylation pattern of calcitonin (CALCA) gene in pediatric acute leukemia.
21391919 2011 Effect of calcitonin gene-related peptide on nitric oxide production in osteoblasts: an experimental study.
21352816 2011 Glial NF-?B inhibition alters neuropeptide expression after sciatic nerve injury in mice.
21289592 2012 Differences in damage to CGRP immunoreactive sensory nerves after two lumbar surgical approaches: investigation using humans and rats.
21219690 2011 Serum procalcitonin in pulmonary tuberculosis.
21216873 2011 Epigenetic regulation of the calcitonin gene-related peptide gene in trigeminal glia.
21211657 2011 Calcitonin gene-related peptide- and vascular endothelial growth factor-positive inflammatory cells in late-phase allergic skin reactions in atopic subjects.
21195698 2011 Association study of calcitonin gene-related polypeptide-alpha (CALCA) gene polymorphism with migraine.
21083886 2010 Procalcitonin reflects bacteremia and bacterial load in urosepsis syndrome: a prospective observational study.
21078153 2010 Predictive value of procalcitonin decrease in patients with severe sepsis: a prospective observational study.
20959432 2010 BDNF and CGRP interaction: implications in migraine susceptibility.
20930646 2010 Procalcitonin, C-reactive protein, and cell counts in the diagnosis of parapneumonic pleural effusions.
20929576 2010 Comparison of thromboelastometry with procalcitonin, interleukin 6, and C-reactive protein as diagnostic tests for severe sepsis in critically ill adults.
20890583 2010 Diagnostic and prognostic role of procalcitonin in infections.
20832068 2010 Calcitonin gene-related peptide inhibits angiotensin II-induced endothelial progenitor cells senescence through up-regulation of klotho expression.
20805714 2010 Clinical significance of serum procalcitonin in patients with community-acquired lobar pneumonia.
20803037 2011 The diagnostic value of CRP, IL-8, PCT, and sTREM-1 in the detection of bacterial infections in pediatric oncology patients with febrile neutropenia.
20699253 2011 The value of serum procalcitonin in differential diagnosis of pulmonary embolism and community-acquired pneumonia.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20654671 2010 Calcitonin gene-related peptide regulates the growth of epidermal stem cells in vitro.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596610 2010 Involvement of vascular endothelial growth factor signaling in CLR/RAMP1 and CLR/RAMP2-mediated pro-angiogenic effect of intermedin on human vascular endothelial cells.
20595156 2011 Prognostic value of procalcitonin in community-acquired pneumonia.
20530033 2011 Usefulness of serum procalcitonin levels in pulmonary tuberculosis.
20441469 2010 Circulating procalcitonin in aseptic carcinoma patients: a specificity study with (18)F-fluorodeoxyglucose positron-emission tomography/computed tomography as benchmark.
20375903 2010 Accelerated senescence of endothelial progenitor cells in hypertension is related to the reduction of calcitonin gene-related peptide.
20233513 Procalcitonin: a novel cardiac marker with prognostic value in acute coronary syndrome.
20214413 2010 Procalcitonin as a prognostic marker in patients with acute myocardial infarction.
20173430 Frequencies of polymorphisms in cytokines, neurotransmitters and adrenergic receptors in patients with complex regional pain syndrome type I after distal radial fracture.
20146986 2010 Prognostic value of inflammatory markers (notably cytokines and procalcitonin), nutritional assessment, and organ function in patients with sepsis.
20146868 Procalcitonin levels as an early marker in patients with multiple trauma under intensive care.
20143189 2011 Breast density, scintimammographic (99m)Tc(V)DMSA uptake, and calcitonin gene related peptide (CGRP) expression in mixed invasive ductal associated with extensive in situ ductal carcinoma (IDC + DCIS) and pure invasive ductal carcinoma (IDC): correlation with estrogen receptor (ER) status, proliferation index Ki-67, and histological grade.
20131075 2010 Comparison between procalcitonin and C-reactive protein for early diagnosis of children with sepsis or septic shock.
20046084 2009 [Comparison of diagnostic utility between procalcitonin and C-reactive protein for the patients with blood culture-positive sepsis].
20010500 2009 Diabetes mellitus decreases the expression of calcitonin-gene related peptide, gamma-amino butyric acid and glutamic acid decarboxylase in human pancreatic islet cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909213 2010 Substance P and calcitonin gene-related neuropeptides as novel growth factors for ex vivo expansion of cord blood CD34(+) hematopoietic stem cells.
19829249 2009 Temporal and spatial CGRP innervation in recombinant human bone morphogenetic protein induced spinal fusion in rabbits.
19797133 2009 Procalcitonin for reduced antibiotic exposure in ventilator-associated pneumonia: a randomised study.
19736013 2010 Association of the calcitonin gene (CA) polymorphism with osteoarthritis of the knee in a Mexican mestizo population.
19715516 2009 Procalcitonin and C-reactive protein serum levels after hematopoietic stem-cell transplant.
19685709 2009 [The investigation for the neuropeptides of nasal septum in perennial allergic rhinitis patient].
19623026 2009 Plasma procalcitonin is an independent predictor of graft failure late after renal transplantation.
19589278 The role of procalcitonin in gynaecological surgery.
19543500 2009 Serum and pleural fluid procalcitonin in predicting bacterial infection in patients with parapneumonic effusion.
19541585 2009 BCL2-938C>A and CALCA-1786T>C polymorphisms in aseptic loosened total hip arthroplasty.
19541012 2009 The value of procalcitonin at predicting the severity of acute pancreatitis and development of infected pancreatic necrosis: systematic review.
19485922 2010 CGRP, a vasodilator neuropeptide that stimulates neuromuscular transmission and EC coupling.
19484659 2009 Procalcitonin values after dialysis is closely related to type of dialysis membrane.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19447044 2009 No association between CALCA polymorphisms and clinical outcome or serum procalcitonin levels in German polytrauma patients.
19440016 2009 Significance of serum calcitonin gene-related peptide levels in prostate cancer patients receiving hormonal therapy.
19299090 2009 Inhibition of Behcet's disease by calcitonin.
19282810 2009 The role of procalcitonin as predictor for neurological deficits after carotid endarterectomy.
19236383 2009 Plasma calcitonin gene-related peptide in diagnosing and predicting paediatric migraine.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19078972 2009 Comparison of serum amyloid A concentrations with those of C-reactive protein and procalcitonin in diagnosis and follow-up of neonatal sepsis in premature infants.
18959118 2008 Association of CALCA genetic polymorphism with essential hypertension.
18953261 2008 Assessment of the prognostic value of certain acute-phase proteins and procalcitonin in the prognosis of acute pancreatitis.
18941191 2008 Calcitonin gene-related peptide biases Langerhans cells toward Th2-type immunity.
18784182 2008 Calcitonin promotes in vivo metastasis of prostate cancer cells by altering cell signaling, adhesion, and inflammatory pathways.
18779512 2008 Calcitonin gene-related peptide does not cause the familial hemiplegic migraine phenotype.
18626012 2008 Preprocalcitonin signal peptide generates a cytotoxic T lymphocyte-defined tumor epitope processed by a proteasome-independent pathway.
18603306 2008 Antimicrobial activity of neuropeptides against a range of micro-organisms from skin, oral, respiratory and gastrointestinal tract sites.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18574663 2008 Usefulness of procalcitonin serum level for the discrimination of severe sepsis from sepsis: a multicenter prospective study.
18556380 Procalcitonin fails to differentiate inflammatory status or predict long-term outcomes in peritoneal dialysis-associated peritonitis.
18525431 2008 The use of procalcitonin determinations in evaluation of systemic lupus erythematosus.
18403669 2008 Prognostic role of clinical and laboratory criteria to identify early ventilator-associated pneumonia in brain injury.
18384419 2008 Comparison of CGRP and NO responses in the human peripheral microcirculation of migraine and control subjects.
18295515 2008 Serum procalcitonin (PCT) as a negative screening test for colonic ischemia after open abdominal aortic surgery.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18211417 2008 The role of selected neuropeptides in pathogenesis of atopic dermatitis.
18197882 2008 Role of calcitonin gene-related peptide and substance P in different models of pain.
18180663 2008 Can emergency physicians identify a high mortality subgroup of patients with sepsis: role of procalcitonin.
18167349 2008 Control of the calcitonin gene-related peptide enhancer by upstream stimulatory factor in trigeminal ganglion neurons.
18057382 2007 Reference range of serum calcitonin levels in humans: influence of calcitonin assays, sex, age, and cigarette smoking.
17983652 2008 Calcitonin promotes outgrowth of trophoblast cells on endometrial epithelial cells: involvement of calcium mobilization and protein kinase C activation.
17941085 2008 Adrenomedullin is anti-apoptotic in osteoblasts through CGRP1 receptors and MEK-ERK pathway.
17934713 2008 Serum procalcitonin and C-reactive protein concentrations to distinguish mildly infected from non-infected diabetic foot ulcers: a pilot study.
17785463 2007 Functional calcitonin gene-related peptide receptors are formed by the asymmetric assembly of a calcitonin receptor-like receptor homo-oligomer and a monomer of receptor activity-modifying protein-1.
17710246 2007 Maternal plasma procalcitonin concentrations in pregnancy complicated by preterm premature rupture of membranes.
17689535 2007 The interaction between endogenous calcineurin and the plasma membrane calcium-dependent ATPase is isoform specific in breast cancer cells.
17676478 2007 Procalcitonin for the clinical laboratory: a review.
17669797 2007 Procalcitonin and brain natriuretic peptide as parameters in the postoperative course of patients with major pulmonary resection.
17558349 2007 Increased plasma levels of soluble triggering receptor expressed on myeloid cells 1 and procalcitonin after cardiac surgery and cardiac arrest without infection.
17552872 2008 Plasma procalcitonin in patients with ileus. Relations to other inflammatory parameters.
17535749 2006 Cytosine-adenine repeat polymorphism at calcitonin gene locus associated with serum osteocalcin level in Japanese women.
17485015 2007 Association between the calcitonin-related peptide alpha (CALCA) gene and essential hypertension in Japanese subjects.
17481780 2007 JNK-AP-1 pathway involved in interleukin-1beta-induced calcitonin gene-related peptide secretion in human type II alveolar epithelial cells.
17441790 2007 Airway expression of calcitonin gene-related peptide in T-cell peptide-induced late asthmatic reactions in atopics.
17381353 2007 Calcitonin levels do not decrease with weaning in chronic alcoholism.
17267696 2007 Calcitonin gene-related peptide (CALCA) is a proangiogenic growth factor in the human placental development.
17251226 2007 Calcitonin gene-related peptide relates to cough sensitivity in children with chronic cough.
17241109 2007 Regulation and enzymatic basis of bone resorption by human osteoclasts.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17149558 2007 N-terminal brain natriuretic propeptide levels correlate with procalcitonin and C-reactive protein levels in septic patients.
17123735 2007 Increased plasma substance P and CGRP levels, and high ACE activity in migraineurs during headache-free periods.
17101796 2007 Role for Fox-1/Fox-2 in mediating the neuronal pathway of calcitonin/calcitonin gene-related peptide alternative RNA processing.
17087112 2006 [The roles of three peptides in the pathogenesis of vasomotor rhinitis].
17038199 2006 Diagnostic value and prognostic implications of serum procalcitonin after cardiac surgery: a systematic review of the literature.
17026622 2006 Association of the CT gene (CA) polymorphism with BMD in osteoporotic Mexican women.
16996466 2006 Circulating calcitonin gene-related peptide and its placental origins in normotensive and preeclamptic pregnancies.
16904178 2006 Effects of the neuropeptides substance P, calcitonin gene-related peptide, vasoactive intestinal polypeptide and galanin on the production of nerve growth factor and inflammatory cytokines in cultured human keratinocytes.
16890288 2007 Aberrant methylation in pediatric myelodysplastic syndrome.
16840549 2006 Ca2+-dependent regulation of calcitonin gene expression by the transcriptional repressor DREAM.
16720289 2006 Effect of pH-variation on insertion and ion channel formation of human calcitonin into planar lipid bilayers.
16712930 2006 Hypermethylation of CpG island in the promoter region of CALCA in acute lymphoblastic leukemia with central nervous system (CNS) infiltration correlates with poorer prognosis.
16710309 2006 Neuropeptide (calcitonin gene-related peptide) induction of nitric oxide in human keratinocytes in vitro.
16611736 2006 CGRP inhibits osteoprotegerin production in human osteoblast-like cells via cAMP/PKA-dependent pathway.
16597919 2006 Calcitonin gene-related peptide inhibits interleukin-1beta-induced endogenous monocyte chemoattractant protein-1 secretion in type II alveolar epithelial cells.
16574742 2006 Calcitonin increases tumorigenicity of prostate cancer cells: evidence for the role of protein kinase A and urokinase-type plasminogen receptor.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16531504 2006 Distinct receptor activity-modifying protein domains differentially modulate interaction with calcitonin receptors.
16511394 2006 Serum procalcitonin concentration in children with liver disease.
16439457 2006 Identification of a signaling pathway involving progesterone receptor, calcitonin, and tissue tranglutaminase in Ishikawa endometrial cells.
16386179 2005 [Clinical study of relationship between serum procalcitonin and severity of multiple organ dysfunction syndrome].
16236878 2005 Usefulness of procalcitonin levels in community-acquired pneumonia according to the patients outcome research team pneumonia severity index.
16014619 2005 Ca2+ signaling in human fetoplacental vasculature: effect of CGRP on umbilical vein smooth muscle cytosolic Ca2+ concentration.
15880427 2005 Calcitonin gene polymorphism CALCA-624 (T/C) and ovarian cancer.
15784626 2005 Endogenous calcitonin gene-related peptide protects human alveolar epithelial cells through protein kinase Cepsilon and heat shock protein.
15761654 2004 The association between calcitonin gene-related peptide (CGRP), substance P and headache in pituitary tumours.
15761041 2005 Autocrine/paracrine role of inflammation-mediated calcitonin gene-related peptide and adrenomedullin expression in human adipose tissue.
15696922 2004 [Distributing and changes of NO and calcitonin gene-related peptide in pharyngeal tissues and plasma in obstructive sleep apnea and hypopnea syndrome].
15621724 2004 Calcitonin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449935 2004 Structural investigations of a human calcitonin-derived carrier peptide in a membrane environment by solid-state NMR.
15319367 2004 Interleukin-1beta induces beta-calcitonin gene-related peptide secretion in human type II alveolar epithelial cells.
15300632 2004 [Increased atria expression of receptor activity-modifying proteins in heart failure patients].
15248232 2004 Expression and function of RANK in human monocyte chemotaxis.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15168342 2004 Effect of octreotide on expression of calcitonin gene in cultured cells of medullary thyroid carcinoma.
14984255 2004 Cellular internalization of human calcitonin derived peptides in MDCK monolayers: a comparative study with Tat(47-57) and penetratin(43-58).
14759258 2004 An unappreciated role for RNA surveillance.
14745805 2004 Structural diversity of amyloid fibril formed in human calcitonin as revealed by site-directed 13C solid-state NMR spectroscopy.
14722252 2004 Characterization of the human calcitonin gene-related peptide receptor subtypes associated with receptor activity-modifying proteins.
14684361 2004 Involvement of calcitonin gene-related peptide in control of human fetoplacental vascular tone.
14668209 2004 Female sex steroid hormones and pregnancy regulate receptors for calcitonin gene-related peptide in rat mesenteric arteries, but not in aorta.
14654229 2003 Calcitonin gene-related peptide partly protects cultured smooth muscle cells from apoptosis induced by an oxidative stress via activation of ERK1/2 MAPK.
14627864 Association of the calcitonin gene (CA) polymorphism with bone mass and bone responsiveness to hormone therapy in postmenopausal Korean women.
14586070 2003 Calcitonin immunoreactivity in neoplastic and hyperplastic parathyroid glands: an immunohistochemical study.
12917321 2003 U1 snRNP-dependent function of TIAR in the regulation of alternative RNA processing of the human calcitonin/CGRP pre-mRNA.
12871824 2003 Modulation of neuronal nicotinic receptor function by the neuropeptides CGRP and substance P on autonomic nerve cells.
12728303 2003 Analysis of systemic and regional procalcitonin serum levels during liver transplantation.
12594852 2003 Intramuscular transfer of naked calcitonin gene-related peptide gene prevents autoimmune diabetes induced by multiple low-dose streptozotocin in C57BL mice.
12590613 2003 Nardilysin cleaves peptides at monobasic sites.
12540523 2003 The role of the 8-18 helix of CGRP8-37 in mediating high affinity binding to CGRP receptors; coulombic and steric interactions.
12529288 2003 Responses to human CGRP, ADM, and PAMP in human thymic arteries.
12517415 2003 In vitro characterization of a human calcitonin receptor gene polymorphism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446725 2003 Effect of electrostatic interaction on fibril formation of human calcitonin as studied by high resolution solid state 13C NMR.
12369791 2002 Involvement of cyclic adenosine monophosphate-dependent protein kinase A and pertussis toxin-sensitive G proteins in the migratory response of human CD14+ mononuclear cells to katacalcin.
12359227 2002 Somatostatin receptor subtype 1-selective activation reduces cell growth and calcitonin secretion in a human medullary thyroid carcinoma cell line.
12234182 2002 The transmembrane domain of receptor-activity-modifying protein 1 is essential for the functional expression of a calcitonin gene-related peptide receptor.
12231407 2002 Calcitonin induces dephosphorylation of Pyk2 and phosphorylation of focal adhesion kinase in osteoclasts.
12220731 2002 Calcitonin gene-related peptide and adrenomedullin release in humans: effects of exercise and hypoxia.
12213903 2002 Calcitonin gene-related peptide (CGRP) and CGRP receptor expression at the human implantation site.
12198603 2002 High concentrations of procalcitonin but not mature calcitonin in normal human milk.
12063634 2002 Somatostatin, but not somatostatin receptor subtypes 2 and 5 selective agonists, inhibits calcitonin secretion and gene expression in the human medullary thyroid carcinoma cell line, TT.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11803621 2001 MRP 8/14 and procalcitonin serum levels in organ transplantations.
11389975 2001 Glycosylation of human CRLR at Asn123 is required for ligand binding and signaling.
11337490 2001 Inhibition of the catalytic activity of cell adhesion kinase beta by protein-tyrosine phosphatase-PEST-mediated dephosphorylation.
11317366 2001 Identification of four novel polymorphisms in the calcitonin/alpha-CGRP (CALCA) gene and an investigation of their possible associations with Parkinson disease, schizophrenia, and manic depression.
11185743 2000 Association of bone mineral density with a dinucleotide repeat polymorphism at the calcitonin (CT) locus.
11014233 2000 Calcitonin receptor regulation and responsiveness to calcitonin in human osteoclast-like cells prepared in vitro using receptor activator of nuclear factor-kappaB ligand and macrophage colony-stimulating factor.
10882736 2000 Visualization of the calcitonin receptor-like receptor and its receptor activity-modifying proteins during internalization and recycling.
10822112 2000 Effects of CGRP on human osteoclast-like cell formation: a possible connection with the bone loss in neurological disorders?
10754330 2000 Calcitonin gene-related peptide induces IL-8 synthesis in human corneal epithelial cells.
10642343 2000 Increased blood pressure in alpha-calcitonin gene-related peptide/calcitonin gene knockout mice.
9685362 1998 Activation of phospholipase C-beta1 via Galphaq/11 during calcium mobilization by calcitonin gene-related peptide.
9620797 1998 RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor.
8940110 1996 The deletion of 14 amino acids in the seventh transmembrane domain of a naturally occurring calcitonin receptor isoform alters ligand binding and selectively abolishes coupling to phospholipase C.
8626685 1996 A cDNA encoding the calcitonin gene-related peptide type 1 receptor.
8468047 1993 High-resolution chromosomal localization of the human calcitonin/CGRP/IAPP gene family members.
8405394 1993 Calcitonin gene expression in normal human liver.
8078488 1994 Cloning and characterization of an abundant subtype of the human calcitonin receptor.
6610687 1984 Calcitonin gene related peptide coding sequence is conserved in the human genome and is expressed in medullary thyroid carcinoma.
6609312 1984 Isolation and characterization of human calcitonin gene-related peptide.
6546550 1984 The complete sequence of human preprocalcitonin.
6327497 1984 Localization of the polymorphic human calcitonin gene on chromosome 11.
6148938 1984 Structure and expression of a gene encoding human calcitonin and calcitonin gene related peptide.
6132180 1983 Katacalcin: a new plasma calcium-lowering hormone.
5760861 1968 [Human calcitonin. Structure of calcitonin M and D].
3872459 1985 Alternative RNA processing events in human calcitonin/calcitonin gene-related peptide gene expression.
3549095 1987 Calcitonin and the peptides from the calcitonin gene.
3492492 1987 Identification in the human central nervous system, pituitary, and thyroid of a novel calcitonin gene-related peptide, and partial amino acid sequence in the spinal cord.
3485540 1986 Ectopic synthesis of high-Mr calcitonin by the BEN lung carcinoma cell line reflects aberrant proteolytic processing.
3266556 1988 Human alpha-calcitonin gene-related peptide (CGRP) is a potent vasodilator in human mesenteric vasculature.
3259294 Human brain calcitonin gene-related peptide (CGRP) is concentrated in the locus caeruleus.
3034287 1986 Expression and function of the human calcitonin/alpha-CGRP gene in health and disease.
3001670 Autoradiographic distribution of 125I calcitonin gene-related peptide binding sites in the rat central nervous system.
2983422 1985 Interaction of calcitonin and calcitonin gene-related peptide at receptor sites in target tissues.
2673764 1989 Regulation of blood calcium in humans.
2578663 1985 Calcitonin gene-related peptide and its binding sites in the human central nervous system and pituitary.
2571128 1989 Structure and methylation of the human calcitonin/alpha-CGRP gene.
2408883 1985 Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma.
2039456 1991 Solution structures of calcitonin-gene-related-peptide analogues of calcitonin-gene-related peptide and amylin.
2001366 1991 A 1H NMR study of human calcitonin in solution.
1988044 1991 Solution structure of human calcitonin gene-related peptide by 1H NMR and distance geometry with restrained molecular dynamics.
1761559 1991 A novel calcitonin carboxyl-terminal peptide produced in medullary thyroid carcinoma by alternative RNA processing of the calcitonin/calcitonin gene-related peptide gene.
1326102 CGRP stimulates the adhesion of leukocytes to vascular endothelial cells.
1318039 1992 Isolation and characterization of peptides which act on rat platelets, from a pheochromocytoma.