Property Summary

Ligand Count 63
NCBI Gene PubMed Count 112
PubMed Score 446.35
PubTator Score 224.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (89)

AA Sequence

MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDN      1 - 70
YQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVV     71 - 140
ELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTC    141 - 210
VGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS                      211 - 262
//

Text Mined References (114)

PMID Year Title