Property Summary

NCBI Gene PubMed Count 109
Grant Count 53
R01 Count 37
Funding $4,216,381.05
PubMed Score 433.10
PubTator Score 224.49

Knowledge Summary

Patent

No data available

Expression

Gene RIF (86)

PMID Text
26884824 KLK1 rs5516 SNP is not related to the incidence of Alzheimer's disease in a Hunan Han Chinese population.
26677174 TK promoted cell survival and beta-catenin degradation in serum-starved SH-SY5Y cells via increasing autophagy.
25448306 The kallikrein system in retinal damage/protection
25100328 Preclinical characterization of recombinant human tissue kallikrein-1 as a novel treatment for type 2 diabetes mellitus.
24626253 Our findings suggest that higher levels of TK in plasma are associated with the presence of CAD and are a predictor of mild coronary arteriosclerosis.
24599937 These data do not support a role for the Tissue kallikrein-kinin system, protective or deleterious, in the development of insulin resistance and diabetes.
24586431 Up-regulation of KLK1 in tubular epithelial cells may mediate pro-inflammatory pathway and PAR activation during diabetic nephropathy.
24530396 Tissue kallikrein facilitated the activation of EGFR, ERK1/2 and p38 cascade. Not p38 but ERK1/2 phosphorylation was severely compromised in cells depleted of EGFR. Impairment of signaling of ERK1/2 seemed not to be restricted to EGFR phosphorylation.
24005896 allele H is a common polymorphism in Japanese and may contribute to decreased reabsorptions of calcium and sodium in the kidney
23874198 Data suggest factor XII binding/autoactivation are increased on surface of hantavirus-infected vascular endothelium; thus, activation of kallikrein-kinin system during hantavirus infection could have profound implications on capillary permeability.
More...

AA Sequence

MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDN      1 - 70
YQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVV     71 - 140
ELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTC    141 - 210
VGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS                      211 - 262
//

Text Mined References (111)

PMID Year Title
26884824 2015 Relationship between the gene polymorphisms of kallikrein-kinin system and Alzheimer's disease in a Hunan Han Chinese population.
26677174 2016 Tissue kallikrein promotes survival and ?-catenin degradation in SH-SY5Y cells under nutrient stress conditions via autophagy.
25448306 2015 The kallikrein system in retinal damage/protection.
25100328 2014 Preclinical characterization of recombinant human tissue kallikrein-1 as a novel treatment for type 2 diabetes mellitus.
24626253 2014 Relation of plasma tissue kallikrein levels to presence and severity of coronary artery disease in a Chinese population.
24599937 2014 Tissue kallikrein deficiency, insulin resistance, and diabetes in mouse and man.
24586431 2014 Tissue kallikrein mediates pro-inflammatory pathways and activation of protease-activated receptor-4 in proximal tubular epithelial cells.
24530396 2014 Tissue kallikrein induces SH-SY5Y cell proliferation via epidermal growth factor receptor and extracellular signal-regulated kinase1/2 pathway.
24005896 2013 A common polymorphism in the tissue kallikrein gene is associated with increased urinary excretions of calcium and sodium in Japanese volunteers.
23874198 2013 Endothelial cell permeability during hantavirus infection involves factor XII-dependent increased activation of the kallikrein-kinin system.
More...