Property Summary

Ligand Count 1
NCBI Gene PubMed Count 117
PubMed Score 675.47
PubTator Score 633.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Tay-Sachs disease 6 0.0 5.0
Disease Target Count P-value
tuberculosis 2010 3.5e-08
ovarian cancer 8520 1.5e-05
subependymal giant cell astrocytoma 2287 3.2e-03
glioblastoma 5792 5.6e-03
diabetes mellitus 1728 7.6e-03
astrocytoma 1146 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gangliosidosis 20 7.979 4.0
Neurodegenerative disease 414 3.126 1.6
Disease Target Count
Familial dysautonomia 3

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.200 3.7e-02
diabetes mellitus -1.200 7.6e-03
glioblastoma 1.700 5.6e-03
ovarian cancer 1.500 1.5e-05
subependymal giant cell astrocytoma 2.324 3.2e-03
tuberculosis 1.100 3.5e-08

Protein-protein Interaction (3)

Gene RIF (36)

AA Sequence

MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRD      1 - 70
LLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLE     71 - 140
TFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPS    141 - 210
FPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSG    211 - 280
SEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQ    281 - 350
LESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPW    351 - 420
YLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLT    421 - 490
SDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT                                   491 - 529
//

Text Mined References (123)

PMID Year Title