Property Summary

Ligand Count 1
NCBI Gene PubMed Count 678
PubMed Score 876.30
PubTator Score 2480.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Familial lipoprotein lipase deficiency 3 0.0 5.0
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 2.905 1.1e-03
active ulcerative colitis 2.853 9.7e-03
adult high grade glioma 1.800 1.7e-02
astrocytoma 3.400 2.0e-22
Astrocytoma, Pilocytic 2.600 3.0e-06
Atopic dermatitis -2.700 3.6e-03
Breast cancer -1.300 8.4e-04
breast carcinoma -2.300 4.1e-03
chronic kidney disease -1.500 4.5e-02
chronic lymphosyte leukemia 1.300 2.4e-03
cutaneous lupus erythematosus 1.500 1.5e-02
dermatomyositis 1.600 3.4e-02
ductal carcinoma in situ -4.300 4.4e-04
fibroadenoma -2.700 1.4e-02
glioblastoma 1.900 4.4e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.9e-02
invasive ductal carcinoma -1.839 1.6e-02
lung adenocarcinoma -1.600 1.8e-08
lung cancer -4.200 1.9e-04
lung carcinoma 1.200 1.3e-11
malignant mesothelioma 1.400 2.8e-05
mucosa-associated lymphoid tissue lympho... 1.434 4.4e-02
nasopharyngeal carcinoma 1.400 3.1e-02
non-small cell lung cancer -3.692 2.1e-26
oligodendroglioma 2.500 8.9e-03
osteosarcoma -1.613 4.7e-02
primitive neuroectodermal tumor 1.800 1.8e-02
psoriasis -1.200 3.9e-03
tuberculosis and treatment for 3 months -1.100 1.0e-02

Gene RIF (656)

AA Sequence

MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFN      1 - 70
HSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN     71 - 140
WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLH    141 - 210
TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL    211 - 280
NEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS    281 - 350
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW    351 - 420
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG                   421 - 475
//

Text Mined References (702)

PMID Year Title