Property Summary

NCBI Gene PubMed Count 641
PubMed Score 847.49
PubTator Score 2480.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
non-small cell lung cancer 2798 2.14658606991221E-26
astrocytoma 1493 2.01421069179462E-22
breast carcinoma 1614 9.4209951748139E-19
oligodendroglioma 2849 1.34201767900465E-18
lung adenocarcinoma 2714 8.17442699656679E-15
lung carcinoma 2844 1.34006339397656E-11
lung cancer 4473 6.09256253092791E-7
pilocytic astrocytoma 3086 1.91620380494553E-6
psoriasis 6685 3.0650235688356E-6
invasive ductal carcinoma 2950 1.1406096238612E-4
pediatric high grade glioma 2712 1.69514020436547E-4
malignant mesothelioma 3163 2.89596516532366E-4
ductal carcinoma in situ 1745 4.43820184607669E-4
Breast cancer 3099 4.45565092505325E-4
glioblastoma 5572 5.06842344873551E-4
active Crohn's disease 918 0.00111079237655499
chronic lymphosyte leukemia 232 0.0023611899864318
tuberculosis and treatment for 6 months 686 0.00306517000798034
Atopic dermatitis 944 0.0036152681515884
active ulcerative colitis 477 0.00728707078856269
fibroadenoma 557 0.0143229239631908
cutaneous lupus erythematosus 1056 0.0146784828435329
primitive neuroectodermal tumor 3031 0.017670227664665
nasopharyngeal carcinoma 1056 0.0313068699592345
dermatomyositis 967 0.0335395827649132
mucosa-associated lymphoid tissue lymphoma 480 0.0438465345321666
chronic kidney disease 90 0.045367253141397
osteosarcoma 7933 0.0466951550432247
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0491922676242586
Disease Target Count Z-score Confidence
Familial lipoprotein lipase deficiency 3 0.0 5.0
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0
Disease Target Count
Lipoprotein lipase deficiency 1

Expression

  Differential Expression (29)

Synonym

Accession P06858 B2R5T9 Q16282 Q16283 Q96FC4 LPL
Symbols LIPD
HDLCQ11

Gene

LPL

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (618)

PMID Text
27159952 It can be suggested that the pronounced hypolipidemic effect of rosuvastatin in homozygotes +495GG of the LPL gene is associated with modulation of the LPL activity, as it has been previously reported for other statin drugs.
26975783 Asn291Ser(rs268), HindIII(rs320) and Ser447Ter(rs328) polymorphisms of lipoprotein lipase were associated with a risk of Alzheimer disease.[meta-analysis]
26503844 Individuals carrying the lipoprotein lipase (LPL) rs12678919 polymorphism (A --> G) had no significant change in the risk of developing AMD.
26420199 Lipoprotein lipase gene affects insulin resistance across different types of tissues.
26388538 capacity for triglyceride clearance seemed to be acutely reduced by alcohol consumption and the effect persisted for several hours. The levels of LPL activity in PHP were reduced to a similar extent
26370976 our results show the involvement of the variants of ESR1, LPL and CETP genes in metabolic events related to MetS or some of its features.
26342331 in well characterized FCHL individuals, variants in LDLR and LPL provide a small contribution to dyslipidemia
26214456 the LPL gene polymorphism was determined to be the main factor related to insulin resistance in women with gestational diabetes.
26188224 LPL polymorphisms may influence HDL-C concentration in lean men and may have a synergetic effect with Apo E to alter plasma triglyceride concentration in overweight men.
26101956 polymorphisms in LPL protect HIV-infected patients from developing atherogenic dyslipidemia in a dose-dependent manner
More...

AA Sequence

MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFN      1 - 70
HSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN     71 - 140
WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLH    141 - 210
TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL    211 - 280
NEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS    281 - 350
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW    351 - 420
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG                   421 - 475
//

Text Mined References (665)

PMID Year Title
27578112 Identification and characterization of two novel mutations in the LPL gene causing type I hyperlipoproteinemia.
27159952 2016 [ESTIMATING THE EFFECTIVENESS OF HYPOLIPIDEMIC THERAPY WITH ROSUVASTATIN IN PATIENTS WITH CORONARY HEART DISEASE DEPENDING ON THE GENOTYPE OF LIPOPROTEIN LIPASE].
26975783 2016 Meta-analyses of four polymorphisms of lipoprotein lipase associated with the risk of Alzheimer's disease.
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26420199 2015 Diets high in carbohydrate may not be appropriate for rs328 G carriers with the metabolic syndrome.
26388538 2015 Acute alcohol consumption downregulates lipoprotein lipase activity in vivo.
26370976 2015 Polymorphisms in the LPL and CETP Genes and Haplotype in the ESR1 Gene Are Associated with Metabolic Syndrome in Women from Southwestern Mexico.
26342331 2015 Contribution of mutations in low density lipoprotein receptor (LDLR) and lipoprotein lipase (LPL) genes to familial combined hyperlipidemia (FCHL): a reappraisal by using a resequencing approach.
26214456 2015 Relationship between a lipoprotein lipase gene polymorphism in placental tissue and insulin resistance in patients with gestational diabetes mellitus.
26188224 Study of common variants of the apolipoprotein E and lipoprotein lipase genes in patients with coronary heart disease and variable body mass index.
More...