Property Summary

NCBI Gene PubMed Count 641
Grant Count 581
R01 Count 344
Funding $80,226,081.6
PubMed Score 847.49
PubTator Score 2480.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Lipid metabolism disorder 102 5.617 2.8
Obesity 616 5.302 2.7
Atherosclerosis 275 4.872 2.4
diabetes mellitus 1,663 4.872 2.4
Coronary artery disease 240 4.484 2.2
Pancreatitis 97 4.363 2.2
Hyperinsulinism 63 4.219 2.1
Metabolic syndrome X 155 4.185 2.1
Hyperglycemia 120 3.37 1.7
Hypertension 287 3.217 1.6
Xanthomatosis 6 3.138 1.6
Animal Mammary Neoplasms 136
Atopic dermatitis 944
Attention deficit hyperactivity disorder 156 1.0
Breast cancer 3,094
Cardiomyopathies 90
Cardiovascular Diseases 50
Cardiovascular system disease 194 2.0
Colonic Neoplasms 126
Coronary heart disease 59
Dyslipidemias 17
Familial hyperlipidemia 6 4.0
Familial lipoprotein lipase deficiency 3 5.0
Hepatitis C 90
Hypercholesterolemia 27
Hypercholesterolemia, Familial 16
Hyperlipidemia 25
Hyperlipidemia, Familial Combined 3
Hyperlipoproteinemia Type I 2
Hyperlipoproteinemia Type V 4
Hypertensive disease 193
Hypertriglyceridemia 18
Mammary Neoplasms, Experimental 150
Necrosis 51
Prostatic Neoplasms 471
Type 2 diabetes mellitus 189 2.0
Vascular disease 281 2.0
active Crohn's disease 918
active ulcerative colitis 477
astrocytoma 1,493
breast carcinoma 1,614
chronic kidney disease 90
chronic lymphosyte leukemia 232
cutaneous lupus erythematosus 1,056
dermatomyositis 933
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis and treatment for 6 months 686

Expression

  Differential Expression (29)

Synonym

Accession P06858 B2R5T9 Q16282 Q16283 Q96FC4 LPL
Symbols LIPD
HDLCQ11

Gene

LPL

PANTHER Protein Class (2)

Gene RIF (618)

PMID Text
27159952 It can be suggested that the pronounced hypolipidemic effect of rosuvastatin in homozygotes +495GG of the LPL gene is associated with modulation of the LPL activity, as it has been previously reported for other statin drugs.
26975783 Asn291Ser(rs268), HindIII(rs320) and Ser447Ter(rs328) polymorphisms of lipoprotein lipase were associated with a risk of Alzheimer disease.[meta-analysis]
26503844 Individuals carrying the lipoprotein lipase (LPL) rs12678919 polymorphism (A --> G) had no significant change in the risk of developing AMD.
26420199 Lipoprotein lipase gene affects insulin resistance across different types of tissues.
26388538 capacity for triglyceride clearance seemed to be acutely reduced by alcohol consumption and the effect persisted for several hours. The levels of LPL activity in PHP were reduced to a similar extent
26370976 our results show the involvement of the variants of ESR1, LPL and CETP genes in metabolic events related to MetS or some of its features.
26342331 in well characterized FCHL individuals, variants in LDLR and LPL provide a small contribution to dyslipidemia
26214456 the LPL gene polymorphism was determined to be the main factor related to insulin resistance in women with gestational diabetes.
26188224 LPL polymorphisms may influence HDL-C concentration in lean men and may have a synergetic effect with Apo E to alter plasma triglyceride concentration in overweight men.
26101956 polymorphisms in LPL protect HIV-infected patients from developing atherogenic dyslipidemia in a dose-dependent manner
More...

AA Sequence

MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFN      1 - 70
HSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN     71 - 140
WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLH    141 - 210
TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL    211 - 280
NEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS    281 - 350
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW    351 - 420
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG                   421 - 475
//

Text Mined References (665)

PMID Year Title
27578112 Identification and characterization of two novel mutations in the LPL gene causing type I hyperlipoproteinemia.
27159952 2016 [ESTIMATING THE EFFECTIVENESS OF HYPOLIPIDEMIC THERAPY WITH ROSUVASTATIN IN PATIENTS WITH CORONARY HEART DISEASE DEPENDING ON THE GENOTYPE OF LIPOPROTEIN LIPASE].
26975783 2016 Meta-analyses of four polymorphisms of lipoprotein lipase associated with the risk of Alzheimer's disease.
26503844 2015 CETP/LPL/LIPC gene polymorphisms and susceptibility to age-related macular degeneration.
26420199 2015 Diets high in carbohydrate may not be appropriate for rs328 G carriers with the metabolic syndrome.
26388538 2015 Acute alcohol consumption downregulates lipoprotein lipase activity in vivo.
26370976 2015 Polymorphisms in the LPL and CETP Genes and Haplotype in the ESR1 Gene Are Associated with Metabolic Syndrome in Women from Southwestern Mexico.
26342331 2015 Contribution of mutations in low density lipoprotein receptor (LDLR) and lipoprotein lipase (LPL) genes to familial combined hyperlipidemia (FCHL): a reappraisal by using a resequencing approach.
26214456 2015 Relationship between a lipoprotein lipase gene polymorphism in placental tissue and insulin resistance in patients with gestational diabetes mellitus.
26188224 Study of common variants of the apolipoprotein E and lipoprotein lipase genes in patients with coronary heart disease and variable body mass index.
More...