Property Summary

NCBI Gene PubMed Count 188
PubMed Score 5758.59
PubTator Score 4955.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Celiac disease 116 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 7.4e-03
astrocytic glioma -1.400 7.9e-03
Astrocytoma, Pilocytic -1.800 1.6e-04
atypical teratoid/rhabdoid tumor -1.100 3.2e-02
Down syndrome -2.000 1.5e-03
ependymoma -1.400 2.0e-02
glioblastoma -1.600 4.7e-06
group 4 medulloblastoma -1.900 2.7e-03
medulloblastoma, large-cell -1.300 3.3e-02
oligodendroglioma -1.400 9.3e-03
osteosarcoma -2.545 1.8e-03
Pick disease -1.300 3.1e-03
primitive neuroectodermal tumor -1.100 3.4e-02

Protein-protein Interaction (2)

Gene RIF (155)

AA Sequence

MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE      1 - 70
EYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNA     71 - 140
LGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK                  141 - 196
//

Text Mined References (187)

PMID Year Title