Property Summary

NCBI Gene PubMed Count 479
Grant Count 132
R01 Count 69
Funding $16,185,829.16
PubMed Score 395.48
PubTator Score 468.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.038
osteosarcoma 2.002 0.003
glioblastoma 1.100 0.029
medulloblastoma, large-cell -2.200 0.000
hereditary spastic paraplegia -1.161 0.003
acute quadriplegic myopathy 1.030 0.000
tuberculosis -2.600 0.000
non-small cell lung cancer 1.006 0.000
diabetes mellitus -1.100 0.005
Breast cancer 2.500 0.029
group 3 medulloblastoma -1.100 0.045
pilocytic astrocytoma 1.400 0.000
nasopharyngeal carcinoma 1.100 0.002
ovarian cancer -1.800 0.001

Synonym

Accession P06756 A0AV67 B0LPF4 B7Z883 B7ZLX0 D3DPG8 E7EWZ6 Q53SK4 Q59EB7 Q6LD15
Symbols CD51
MSK8
VNRA
VTNR

Gene

PDB

4MMX   4MMY   4MMZ   4UM9   1JV2   1L5G   1M1X   1U8C   3IJE   4G1E   4G1M   4O02   4UM8  

Gene RIF (388)

PMID Text
26901152 Integrins alphavbeta6 and alphavbeta8 were expressed in non-overlapping patterns by keratinocytes and maintained the epidermal residence of Langerhans cells and tissue resident memory T cells by activating latent TGF-beta.
26663660 In this study, the long binding helix of this ligand was downsized to an enzymatically stable cyclic peptide endowed with sub-nanomolar binding affinity toward the alphavbeta6 receptor and remarkable selectivity against other integrins
26334633 These findings suggest that enhanced integrin alphavbeta3 expression in addition to enhanced FGFR1 expression is critical for FGF1 to augment TGF-beta1-induced EMT in mammary epithelial cells.
26222911 The combined impacts of alphav-integrin and HER2 influence the invasive phenotype of breast cancer cells.
26165836 ERK-mediated transcription regulation of the alphav monomer is regulated by T3. Thyroid hormones are potent alphavbeta3-ligands, driving ovarian cancer cell proliferation.
26157134 Herpes simplex virus entry is enabled by gH/gL interaction with alphavbeta6- or alphavbeta8-integrin receptors.
25982998 targeting eIF4E in integrin avb6 expressing tumors can be a potential therapeutic strategy for patients with colon cancer.
25889845 These results suggest that melatonin exerts anti-migratory and anti-invasive effects on glioma cells in response to hypoxia via reactive oxygen species-alphavbeta3 integrin-FAK/Pyk2 signaling pathways.
25862865 Our results show that the acquisition of metastatic competence by melanoma cells is accompanied by alteration of alphavbeta3 integrin glycosylation and that both avb3 and b1-6-branched sialylated complex-type N-glycans promote metastatic melanoma migration
25858144 our observations suggest that miR-25 is a key regulator of invasiveness in human prostate cancer through its direct interactions with av- and a6-integrin expression
More...

AA Sequence

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGA      1 - 70
PKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAP     71 - 140
LYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ    141 - 210
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL    211 - 280
GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ    281 - 350
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI    351 - 420
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKT    421 - 490
CSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRG    491 - 560
GLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN    561 - 630
VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF    631 - 700
KTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLA    701 - 770
AVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY    771 - 840
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCL    841 - 910
KIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN    911 - 980
VTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET      981 - 1048
//

Text Mined References (490)

PMID Year Title
26901152 2016 Stromal cells control the epithelial residence of DCs and memory T cells by regulated activation of TGF-?.
26663660 2016 Stable Peptides Instead of Stapled Peptides: Highly Potent ?v?6-Selective Integrin Ligands.
26334633 2015 Enhanced Expression of Integrin ?v?3 Induced by TGF-? Is Required for the Enhancing Effect of Fibroblast Growth Factor 1 (FGF1) in TGF-?-Induced Epithelial-Mesenchymal Transition (EMT) in Mammary Epithelial Cells.
26222911 2015 Interactions between ?v-Integrin and HER2 and Their Role in the Invasive Phenotype of Breast Cancer Cells In Vitro and in Rat Brain.
26165836 2016 The thyroid hormone-?v?3 integrin axis in ovarian cancer: regulation of gene transcription and MAPK-dependent proliferation.
26157134 2015 Dissociation of HSV gL from gH by ?v?6- or ?v?8-integrin promotes gH activation and virus entry.
25982998 2015 Integrin ?6 can be translationally regulated by eukaryotic initiation factor 4E: Contributing to colonic tumor malignancy.
25900259 2015 Periostin of human periodontal ligament fibroblasts promotes migration of human mesenchymal stem cell through the ?v?3 integrin/FAK/PI3K/Akt pathway.
25889845 2015 Involvement of ROS-alpha v beta 3 integrin-FAK/Pyk2 in the inhibitory effect of melatonin on U251 glioma cell migration and invasion under hypoxia.
25862865 2015 Aberrant glycosylation of ?v?3 integrin is associated with melanoma progression.
More...