Property Summary

NCBI Gene PubMed Count 479
PubMed Score 395.48
PubTator Score 468.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.200 3.8e-02
osteosarcoma 2.002 2.8e-03
glioblastoma 1.100 2.9e-02
medulloblastoma, large-cell -2.200 2.8e-04
hereditary spastic paraplegia -1.161 3.0e-03
acute quadriplegic myopathy 1.030 1.2e-04
tuberculosis -2.600 2.8e-08
non-small cell lung cancer 1.006 5.0e-12
diabetes mellitus -1.100 4.8e-03
Breast cancer 2.500 2.9e-02
group 3 medulloblastoma -1.100 4.5e-02
pilocytic astrocytoma 1.400 1.2e-06
nasopharyngeal carcinoma 1.100 1.8e-03
ovarian cancer -1.800 9.7e-04

Gene RIF (383)

PMID Text
26901152 Integrins alphavbeta6 and alphavbeta8 were expressed in non-overlapping patterns by keratinocytes and maintained the epidermal residence of Langerhans cells and tissue resident memory T cells by activating latent TGF-beta.
26663660 In this study, the long binding helix of this ligand was downsized to an enzymatically stable cyclic peptide endowed with sub-nanomolar binding affinity toward the alphavbeta6 receptor and remarkable selectivity against other integrins
26334633 These findings suggest that enhanced integrin alphavbeta3 expression in addition to enhanced FGFR1 expression is critical for FGF1 to augment TGF-beta1-induced EMT in mammary epithelial cells.
26222911 The combined impacts of alphav-integrin and HER2 influence the invasive phenotype of breast cancer cells.
26165836 ERK-mediated transcription regulation of the alphav monomer is regulated by T3. Thyroid hormones are potent alphavbeta3-ligands, driving ovarian cancer cell proliferation.
26157134 Herpes simplex virus entry is enabled by gH/gL interaction with alphavbeta6- or alphavbeta8-integrin receptors.
25982998 targeting eIF4E in integrin avb6 expressing tumors can be a potential therapeutic strategy for patients with colon cancer.
25889845 These results suggest that melatonin exerts anti-migratory and anti-invasive effects on glioma cells in response to hypoxia via reactive oxygen species-alphavbeta3 integrin-FAK/Pyk2 signaling pathways.
25862865 Our results show that the acquisition of metastatic competence by melanoma cells is accompanied by alteration of alphavbeta3 integrin glycosylation and that both avb3 and b1-6-branched sialylated complex-type N-glycans promote metastatic melanoma migration
25858144 our observations suggest that miR-25 is a key regulator of invasiveness in human prostate cancer through its direct interactions with av- and a6-integrin expression
25857463 The driving role of the tumour microenvironment on CRC dissemination, here detected, and described, strengthens and adds new value to the concept that a5b1 integrin can be an appropriate and relevant therapeutic target for the control of CRC metastases.
25849225 alphav integrin is required for efficient TGF-beta/Smad signaling and TGF-beta-induced breast cancer cell migration, and for maintaining a mesenchymal phenotype of the breast cancer cells.
25749383 Osteopontin might promote a cancer stem cell-like phenotype via the alphavbeta3-NF-kappaB-HIF-1alpha pathway in hepatocellular carcinoma.
25745053 high levels of alphavbeta6 integrin may identify a specific endotype of progressive fibrotic lung disease
25663698 alpha5beta1 and alphavbeta3 each mediate actin cytoskeletal remodeling in response to stiffening or cyclic stretching of the extracellular matrix.
25604835 Either mutation of two amino acids (D205A,D207A), or deletion of seven amino acids (Del202-208) of the Borrelia burgdorferi P66 protein significantly reduced binding ability to integrin alphavbeta3.
25572981 Integrin alphavbeta3 is required for cathepsin B-induced hepatocellular carcinoma progression
25497015 suggest that the OPN-integrin alphavbeta3 axis is crucial for 5-FU resistance in oral scandalous cell carcinoma
25488971 Integrin alphaVbeta3 acting as membrane receptor for thyroid hormones mediates angiogenesis in malignant T cells.
25398877 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrin alphaVbeta3, integrin alphavbeta1, and integrin alpha4beta1.
25370835 Integrin alphav promotes the proliferation of the human lung cancer cell line A549 by activating the ERK 1/2 signaling pathway
25320004 The identification of integrin alphavbeta6 in a subset of DCIS presents a unique way to stratify patients with DCIS into those who may or may not progress to more serious disease.
25318615 Unique sites of interaction between alphavbeta6 and uPAR are most likely located in uPAR domains II and III.
25290158 post-treatment of peptides derived from the full-length tail or from the turn motif did not reverse aIIb and aV integrin activation.
25277122 Exogenous ATX controls breast cancer cell proliferation, invasion, and endothelial cell transmigration via interaction tumor integrin alphaVbeta3.
25275062 The overexpression of ITGAV gene was associated with higher progression and spread of CRC via perineural invasion.
25273699 The importance of interaction between EDIL3 and integrin alphaV.
25263164 Low NAMPT is associated with upregulation of alphavbeta3 integrin in breast tumor cells.
25249331 Inhibition of tumor-associated alphavbeta3 integrin regulates the angiogenic switch by enhancing expression of IGFBP-4 leading to reduced melanoma growth and angiogenesis in vivo.
25193465 Suggest a role for cyclin D1b as a possible mediator of alphavbeta3 transcription to promote breast tumor metastasis.
25190218 overexpression of integrin alphav induces integrin alphavb8 heterodimer formation and the binding of integrin alphavbeta8 to type collagen might enhance the proliferation and invasion of SCC cells via the activation of the MEK/ERK signaling pathway.
25174803 The levels of integrin alpha(nu)beta(3) between normal skin and hypertrophic scar tissues were compared, and integrin alpha(nu)beta(3) was found to be upregulated in hypertrophic scar.
25150423 Expression of alphav integrin subunits seem to be of pathobiological and clinical relevance in patients with non-small cell lung cancer with brain metastases.
25150077 the present study demonstrated that the link between systemic inflammatory markers and the ITGAV-rs3911238 polymorphism allele in Iranian RA patients.
25117682 alphavbeta3 was necessary and sufficient for Slug activation
25063885 Herpesvirus 8 attachment and entry are dependent on alphaVbeta3 integrin localized to specific cell surface microdomains.
24942591 Coimmunoprecipitation studies and proximity ligation assays indicated that integrin alphavbeta3 interacts with herpes simplex virus type 2 glycoprotein H (gH).
24939290 Studies sugggest that the effect of integrin alphavbeta3 in the whole process of brain function recovery merits further study.
24789099 Data show that chemokine domain of fractalkine (FKN-CD) can activate alphavbeta3 integrin in the absence of fractalkine receptor CX3CR1, but that this activation requires the direct binding of FKN-CD to alphavbeta3.
24785587 The increased surface expression of alpha5beta1 integrin, along with the adhesion between the cells and fibronectin, could be inhibited by both ataxia telangiectasia mutated (ATM) and Rad3-related (ATR) kinase inhibitors
24737780 These results suggest that AGM cooperates with VEGF to induce the aberrant functions of cancer vasculature as a ligand of integrin alpha5beta3.
24737028 This co-targeting strategy relies on the interaction of MMP-2 with integrin a(v)b(3), which are known to associate via the hemopexin domain of MMP-2
24699825 In pancreatic adenocarcinoma cells, PAR3 knockdown enhances cell adhesion. We propose this is due to increased expression of E-cadherin, leading to a greater adhesion of free-floating cells to cells bound to the surface via integrins, particularly ITGalphav.
24695839 Overexpression of integrin alphav is associated with advanced T and N stage and as an independent prognostic factor in colorectal carcinoma.
24690239 The use of LIF in combination with alphanubeta3 integrin as biomarkers appears to be superior to integrin testing alone when evaluating endometrial receptivity, primarily because of its earlier pattern of expression during the secretory phase.
24639195 Integrins alphavbeta5 and alphavbeta3 both control myofibroblast differentiation by activating latent TGF-beta1
24573955 Expression of Gli1 and alphavbeta6 inversely correlates in tumours in vivo, and Hh targeting up-regulates TGF-beta1/Smad2/3-dependent alphavbeta6 expression, promoting pro-tumourigenic cell functions in vitro.
24515920 cilengitide can significantly down-regulate ITGAV expression and inhibit cell proliferation in laryngeal cancer cells, it will also to induce cell apoptosis through caspase-3 pathway.
24498405 High integrin alphaVbeta3 expression is associated with hepatocellular carcinoma.
24478423 alpha5beta1 and alphav integrins are essential for cell-cell fusion and hMPV infection.
24464580 CCN2 and inflammatory cytokines form a functional negative feedback loop in NP cells involving interleukin-1beta through alpha5beta1 and alphaVbeta3 integrins that may be important in the pathogenesis of disc disease
24424369 Inhibition of integrin alphavbeta3 results in significant inhibition of trophoblast attachment.
24412187 [(18)F]Galacto-RGD PET/CT shows specific tracer accumulation in human atherosclerotic carotid plaques, which correlates with alphavbeta3 expression.
24389192 findings suggest that Alpha(v)Beta5 integrins and their natural ligand VN are involved in P. fluorescens adherence and invasion in human epithelial cells
24375314 Results suggest that the ITGAV gene may be a candidate gene for the etiopathogenesis of rheumatoid arthritis.
24367260 alphavbeta6- and alphavbeta8-integrins acted independently and are thus interchangeable as receptors for Herpes simplex type 1 virus entry.
24363825 Complement C3, vitronectin, and apolipoprotein A-I were further confirmed by western blotting, and the results showed that their contents decreased significantly after transient limb ischemia.
24294359 Brain metastases ITGAV expression exhibits considerable heterogeneity according to tumor origin.
24150233 upregulation of alphavbeta6 on myoepithelial cells generates a tumor promoter function through TGFbeta upregulation of MMP-9. These data suggest that expression of alphavbeta6 may be used to stratify patients with DCIS.
24023288 GIC lines and their derived differentiated cultures expressed CD95 on the cell surface and were sensitive towards APO010-mediated cell death to a variable extent
23992637 The level of OPN expression in lung adenocarcinoma was associated with decreased apoptotic activity of tumor cells, and correlated with alphav integrin expression, particularly in low stage tumors.
23898055 Real-time imaging of alphav integrin molecular dynamics in human 143B osteosarcoma cells in vitro and in vivo, is reported.
23845726 Interaction between CCL2 and CCR2 enhances migration of prostate cancer cells through an increase in alphavbeta3 integrin production
23845472 We report a protein expression profile in high-grade osteosarcoma associating beta5 integrin, FAK, and GSK3beta that significantly correlates with poor response to neoadjuvant chemotherapy.
23840404 A switchblade-like movement of the integrin leg is indispensable for the affinity regulation of alphaVbeta3 integrin.
23821196 The alphavbeta5 integrin-FAK-mediated pathway regulates phagocytosis in trabecular meshwork cells and this pathway is inhibited by activation of alphavbeta3 integrins.
23776077 PDGFRalpha CD51 cells in fetal bone marrow represent a small subset of CD146 cells expressing Nestin and enriched for mesenchymal stem cell and hematopoietic stem cell niche activities.
23744557 Vinblastine resistance in renal cell carcinoma can be ascribed to the overexpression of P-gp, which is regulated by the activation of the PI3K/Akt pathway and triggered by upstream CCN1-integrin avb3 interaction.
23726972 Exposure of smooth muscle cells to apo(a) in migration assays induced a potent, concentration-dependent chemorepulsion that was RhoA and integrin alphaVbeta3-dependent, but transforming growth factor beta-independent.
23725446 the expression of Lewis y antigen, integrin alphav and ovarian cancer's clinical stage are both independent, drug resistance-related risk factors.
23722547 Interaction of vitronectin with integrin alphavbeta3 results in the continued activation of the kinase mTOR.
23704872 The coupling of extracellular matrices to integrin alphaV is necessary for Glioma initiating cell differentiation.
23618859 Data indicate CCN1 can induce actin reorganization, formation of lamellipodia, and cell migration/invasion through the alphaV integrins/Rac1/ERK signaling axis; these CCN1-dependent activities can be effectively suppressed by monoclonal antibody YM1B.
23615713 Results show that stromal cell-derived factor-1 (SDF-1) enhanced ovarian cancer cell invasion through alphavbeta6 integrin-mediated urokinase-type plasminogen activator (uPA) expression via the p38 MAPK and PI3 K/Akt pathway.
23462327 Data suggest that the integrin alphaVbeta5 receptor is largely responsible for mediating the differentiation process in pancreatic cells.
23412966 the integrin avb6 plays an important role in the fusion of endosome/lysosome in corneal epithelial cells; inhibition of avb6 results in corneal epithelial barrier dysfunction.
23399898 Our data indicate that expression of [alpha]v[beta]3 in tumor cells and vessels is dependent on tumor grade, and that its expression in tumor cells may have a prognostic impact.
23386126 Data indicate that EGFL7 and integrin alphavbeta3 integrin colocalized in vesicular structures in uman umbilical vein endothelial cells (HUVECs).
23331428 Increased alphavbeta6 integrin expression is associated with poor prognosis and decreased survival in oral squamous cell carcinoma patients.
23283986 alphavbeta8 integrin, via interactions with RhoGDI1, regulates activation of Rho proteins to promote glioblastoma multiforme cell invasiveness.
23269786 study demonstrate that binding of integrin alphavbeta5 and alpha defensin 5 have opposite effects on the elastic response of adenovirus type 35, revealing a direct link between virus-host interactions and the mechanical properties of the capsid
23261238 integrin alphavbeta5 might play an important role in invasion and metastases of laryngeal squamous cell carcinoma
23238957 Integrins alphavbeta3 and alphavbeta5 and their ligands are expressed in distinct and heterogeneous patterns in primary and secondary central nervous system neoplasms.
23227240 CTGF increased IL-6 production in osteoarthritic synovial fibroblasts via the alphavbeta5 integrin, ASK1, p38/JNK, and AP-1/NF-kappaB signaling pathways.
23204516 CtsH-mediated processing of talin might promote cancer cell progression by affecting integrin alphaVbeta3 activation and adhesion strength
23181508 RGD peptide plays an important role in the modulation of cell motility and in the perturbation of cell attachment affecting the malignant potential of breast cancer cells via binding to integrin alphavbeta3.
23161541 alphavbeta3 integrin and nucleolin interact to regulate endothelial and glioma cell migration
23152803 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
23150579 propose that alphavbeta3-integrin is considered a class of non-TLR pattern recognition receptors.
23128103 overexpression of the ITGAV gene and protein was correlated with an increased risk of perineural invasion in colorectal cancer.
23125415 Consistent with prediction, docking simulation studies of fractalkine's chemokine domain show direct interaction with integrins alphavbeta3 and alpha4beta1 at very high affinity.
23119061 Overexpression of osteopontin, alphavbeta3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23106217 observations suggest that the lack of simultaneous binding of metal ions to all three betaI domain sites in alphaVbeta3 is most simply explained as an artifact of crystallization conditions
23053782 The results demonstrate a non-redundant role for alpha(v)beta(3) in gremlin-induced angiogenesis.
23028753 Saccharomyces boulardii supernatant contains motogenic factors that enhance cell restitution through multiple pathways, including the dynamic fine regulation of alphavbeta5 integrin binding activity.
23022044 thioridazine regulates endothelial cell functions that are relevant to angiogenesis through the suppression of the alphavbeta3/FAK/mTOR signaling pathway
22975325 The Protein kinase D (PKD) mediates signals from the platelet-derived growth factor receptor (PDGF-R) to control alphavbeta3 integrin recycling.
22966907 CD44 signaling regulates phosphorylation of RUNX2. Localization of RUNX2 in the nucleus requires phosphorylation of Smad-5 by integrin alphavbeta3 signaling.
22879933 These studies implicate ASM as a mediator of apoptosis induced by inhibition of integrins alphavbeta3/alphavbeta5, and for the first time place c-Abl as an upstream regulator of ASM expression and activity.
22837212 Epstein-Barr virus latent membrane protein-2A induces ITAM/Syk- and Akt-dependent epithelial migration through alphav-integrin membrane translocation
22787119 our findings indicate that alphavbeta6 and TGF-beta act in a common tumor suppressor pathway
22721769 alpha5 endothelial cell-transgenic knockout mice display an attenuated angiogenic response which correlates with delayed endothelial proliferation; primary alpha5KO brain endothelial cells in culture exhibit delayed growth and proliferation.
22719931 In vivo, we found that irradiation combined with alphaV integrin blocking treatment significantly enhanced the radiosensitivity of NPC xenografts
22710795 Collectively, our results indicate that FAS1 domain protein, in addition to its inhibitory effect on alpha5-beta-3 integrin-mediated angiogenesis, also inhibits VEGF165-induced angiogenesis
22659470 Active MMP-2 regulates VEGF-A in melanoma cells on a transcriptional level via an integrin alphavbeta5/phosphoinositide-3-kinase-dependent pathway.
22566688 knockdown of endogenous alphavbeta5 expression or treatment with a function-blocking alphavbeta5 antibody significantly decreased stabilin-2-mediated phagocytosis in the absence of soluble factors
22547930 Further characterized the intermolecular interactions between alphavbeta3 integrin and hormone analogues. Data reveal T(3) and T(4)ac bind in two different modes, occupying two alternate binding sites on alphavbeta3 integrin.
22528484 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
22469980 Dido1 induces the expression of Integrin alphaV, thereby promoting the attachment, migration, invasion and apoptosis resistance of melanoma cells.
22362758 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
22308022 Disulfide bonds in EGF domains of beta3 affect structure and function of alphaIIbbeta3 and alphavbeta3 integrins in different manner.
22174124 MIF enhanced the migration of chondrosarcoma cells by increasing alphavbeta3 integrin expression through the PI3K/Akt/NF-kappaB signal transduction pathway.
22132110 Thyroid hormone is shown to induce human lung cancer cell proliferation via crosstalk between integrin alphavbeta3 and ERalpha.
22110279 Data show that alphav integrin is a new gastrin target in pancreatic cancer models and contributes to gastrin effects on cell adhesion.
22094875 Integrin-alphavbeta3 was upregulated on various therapy-resistant tumor cells through chronic activation of ATM/Chk2-and NFkappaB-mediated pathways
22081516 Chromosomal regions of homozygous loss, encompassing the ITGAV and RUNX1 gene, were detected in multiple samples indicating a potential role in the carcinogenesis of esophageal adenocarcinoma.
22081074 an important role of PTTG in regulation of integrins alpha(V) and beta(3) and adhesion-complex proteins leading to induction of EMT
21978494 alphanubeta3 and alphanubeta5 have roles in photon-induced hypermigration of malignant glioma cells
21957301 The authors report that integrin alphavbeta5 can also bind to Epstein-Barr virus gHgL and trigger fusion.
21853313 Overexpression of integrin alphav in laryngeal and hypopharyngeal carcinomas associated with differentiation and metastasis
21787362 The alphav integrins are an important group of adhesion molecules involved in the migration and invasion of tumour cells.
21764795 analysis of alpha(nu)beta(3) integrin expression by (64)Cu- and (68)Ga-labeled RGD conjugates
21752283 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21748756 Integrin alpha(nu) beta(3), NTRS1 and PSCA mRNA expression increased with tumorigenic potential, but mRNA expression levels for these proteins do not translate directly to equivalent expression levels of membrane bound protein.
21712047 The mechanism of decreased cell migration, a prerequisite for metastasis and invasion, due to increased CAR expression may be explained by reduced alphavbeta3 integrin expression.
21677875 Data showt targeting of alpha(v)-integrin by GLPG0187 can inhibit both de novo formation as well as progression of bone metastases in prostate cancer.
21646718 Data suggest that lung fibroblast chemokine secretion directs dendritic cell trafficking, in a manner that is critically dependent on alphavbeta8-mediated activation of TGF-beta by fibroblasts.
21590707 IL-8 increases integrin alpha V expression and cell motility in human chondrosarcoma cells
21530503 With increased tension cytoskeletal stress fibers develop that contain alphaSMA and alphavbeta3 integrin that replaces alpha2beta1 integrin, consistent with cell switching from collagen to non-collagen proteins interactions.
21433063 Integrin alphavbeta3 promotes vitronectin gene expression in human ovarian cancer cells by implicating rel transcription factors
21427239 Direct contact between tumor cells and human epithelial-like stem cells treated with DMBA increased integrin alpha V expression and caused local activation of the transforming growth factor (TGF)-beta1/Smad signaling pathways.
21425129 Our findings indicate that alphavbeta5 integrin may be involved in the change that occurs in monolayer-cultured chondrocytes after plating
21379327 Performed molecular dynamics to simulate forced unbending of a complete integrin alpha(v)beta ectodomain in both unliganded and liganded forms.
21375561 Alpha v integrin was expressed at robust levels in tumor cells representing less differentiated, more invasive components of squamous cell carcinomas
21352421 S100A4 protects gastric cancer cells from anoikis by regulation of alphav and alpha5 integrin expression, which sheds a novel light for the role of S100A4 in cancer metastasis
21347514 chemokine receptor 7 regulates cell adhesion and migration via integrin alpha v beta 3 in metastatic squamous cell carcinoma of the head and neck
21344378 CCN3 enhances the migration of chondrosarcoma cells by increasing MMP-13 expression through the alphavbeta3/alphavbeta5 integrin receptor, FAK, PI3K, Akt, p65, and NF-kappaB signal transduction pathway.
21321268 data demonstrated that (18)F-fluciclatide detected changes in tumor uptake after acute antiangiogenic therapy markedly earlier than any significant volumetric changes were observable.
21321266 PET of alphavbeta3-integrin and alphavbeta5-integrin expression with 18F-fluciclatide for assessment of response to targeted therapy.
21283814 the role of acidic extracellular pH in regulating activation of integrin alpha(v)beta(3).
21182210 ITGAV is present in all cortical layers, the striatum and Purkinje cells. It is known to be involved in cortical development
21178476 The authors demonstrated that both integrins alphavbeta6 and alphavbeta8 can serve as specific receptors for Epstein-Barr virus gHgL proteins.
21150164 Integrin alphav is the main CAM subunit of uterine leiomyomas that involve angiogenesis
21135163 When polymorphonuclear leukocytes are recruited to tumor cells in a tumor microenvironment, alphaVbeta3 and intercellular adhesion molecule (ICAM)-1 may participate in multistep fibrin(ogen)-mediated melanoma cell adhesion within the circulation.
21116829 ITGAV is a genetic determinant for the severe progression of primary biliary cirrhosis in Japanese patients
21098231 beta5 integrin is identified as the most important partner of the alpha vitronectin-coupled integrin dimer in monocyte-derived macrophages, thus rendering these cells more susceptible to NF-kappaB-dependent HIV-1 infection.
21037076 TF-PAR-1 pathway contributes to liver fibrosis induced by chronic cholestasis by increasing expression of the alphaVbeta6 integrin, an important regulator of transforming growth factor-beta1 activation.
20972812 Results show that uPAR expression regulates the adhesive and migratory ability of CXCR4-expressing cells through a mechanism involving fMLP receptors and alpha-v integrins.
20945385 Leptin stimulates the migration of human prostate cancer cells via transcriptional up-regulation of alphavbeta3 integrin expression.
20942236 The mRNA levels of IntegrinalphaV and Integrinbeta8 were significantly higher in LSCC tissues than that in corresponding adjacent normal tissues.
20926544 Observational study of gene-disease association. (HuGE Navigator)
20857483 TNF-alpha enhances the migration of chondrosarcoma cells by increasing alphavbeta3 integrin expression through the MEK/ERK/NF-kappaB signal transduction pathway.
20838674 Saturation transfer difference NMR was applied to the interaction of the integrin alphavbeta6 with a known peptide ligand and highlights novel contact points between the substrate and target protein
20837477 Data showed that EhPCP5 RGD motif is a ligand for alpha(V)beta(3) integrin-mediated adhesion on colonic cells and represents a novel mechanism to trigger an inflammatory response in the pathogenesis of intestinal amebiasis.
20826760 Preincubation of macrophages with HMGB1 decreased their ability to engulf apoptotic neutrophils or thymocytes. Soluble alphavbeta3 integrin, but not soluble alphavbeta5 integrin, prevented this inhibition.
20826760 These results demonstrate that HMGB1 blocks alpha(v)beta(3)-dependent recognition and uptake of apoptotic cells.
20719960 PAK4 is activated by cell attachment to vitronectin as mediated by PAK4 binding partner integrin alphavbeta5.
20715172 Periostin could be a biochemical marker of the early stromal response associated to breast cancer bone metastasis formation.
20672329 demonstrate that alphaVbeta3 ligation results in sustained increases of PI3 kinase/Akt-dependent binding of transcription factor NF-kappaB to DNA.
20638909 immunohistochemistry of the endometrium indicates that the use of osteopontin and alphavbeta3 integrin as targets for contraceptive approaches or understanding of the pathogenesis of infertility offer little benefit compared with histological dating
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626753 Data show that knockdown of integrin alphav and erbB3 by small-interfering RNAs significantly inhibited cell migration induced by HRG.
20615244 Integrin alphavbeta5 is a primary receptor for adenovirus.
20605574 Integrin alphavbeta3 and Lewis Y, which is contained within it, are expressed in secretory-stage endometrial tissue.
20600001 A fragment of vitronectin containing the RGD integrin binding site showed similar binding affinity as that of full vitronectin protein to purified integrin alphavbeta3 but had diminished cell adhesion and spreading function in vivo.
20558745 Secreted heat shock protein 90alpha induces colorectal cancer cell invasion through CD91/LRP-1 and NF-kappaB-mediated integrin alphaV expression.
20554778 Alpha(V)beta(6), but not alpha(V)beta(3), blocked human parechovirus 1 cellular infectivity.
20519501 the Tie2/alphavbeta3 integrin association-induced integrin internalization and degradation are mechanistic consequences of endothelial Ang-2 stimulation
20477989 These results suggest that PKD1-regulated alphavbeta3 trafficking contributes to the angiogenesis process by integrating VEGF-A signaling with extracellular matrix interactions.
20400979 Ovarian cancer ascites induces FAK and Akt activation in an alphavbeta5 integrin-dependent pathway, which confers protection from TRAIL-induced cell death and caspase activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306691 Results proved the importance of VEGF and integrin alphavbeta3 in the pathogenesis of AML.
20224109 Expression of integrin alphaVbeta3 on T lymphocytes does not predict its endometrial expression.
20158572 Data show that PLT adhesion to HIMEC was ICAM-1, FKN and integrin alpha(v)beta(3) dependent.
20121756 Mast cell-bronchial smooth muscle cell adhesion involved collagen, CD44, and CD51, particularly under inflammatory conditions.
20037822 OPN and its receptor integrin alphanubeta3 may be involved in the pathogenesis of preeclampsia.
20033473 Data show that cartilage oligomeric matrix protein (COMP) promotes cell attachment via independent mechanisms involving cell surface CD47 and alphaVbeta3 integrin and that cell attachment to COMP induces formation of fascin-stabilized actin microspikes.
20026907 Definitive endoderm highly express the integrins alphaV and beta5, which have the ability to bind to vitronectin.
20019187 Reduced expression of integrin beta8 may be involved in the pathogenesis of sporadic brain arteriovenous malformations.
19998373 Blocking integrin alpha V beta 3 inhibits differentiation and subsequently tumor formation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910644 The angiogenic effects of leptin are mediated by circulating angiogenic cells and involve src kinase dependent phosphorylation of integrin alphavbeta5.
19889638 Oscillatory shear stress induces osteoblast-like cell proliferation through activation of alpha(v)beta(3) and beta(1) integrins and synergistic interactions of FAK and Shc with PI3K, leading to the modulation of ERK and Akt/mTOR/p70S6K pathways.
19888537 VEGFR-2 was significantly upregulated by alpha-v suppression in HUVEC & downregulated in HMVEC at mRNA & protein levels. Suppression of alpha-v can either augment or inhibit VEGFR-2 levels & VEGF-induced proliferation in EC from different vascular beds.
19888429 GPIIb/IIIa and alphavbeta3 integrins are important mediators in the pathology of cervical cancer.
19882657 suggest that a divalent metal-ion coordination was a common driving force for the formation of both SDV/alpha v beta 3 and RGD/alpha v beta 3 complexes.
19837659 alphav beta3 integrin may, in part, negatively regulate VEGF signaling by sequestering NRP1 and preventing it from interacting with VEGFR2
19818132 Association of ITGAV SNP rs7378919 with rhuematoid arthritis was not replicated in New Zealand or Oxford case control sample sets
19818132 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19815712 Data show that under basal conditions, sphingosine kinase-1, integrin alpha(v)beta(3), and CD31 exist as a heterotrimeric complex which is required in SK-1-mediated endothelial cell survival.
19811096 Beta1 integrins are required for adhesion and proliferation of induced pluripotent stem cells on matrigel. On vitronectin, the integrin alphavbeta5 is required for initial attachment, but both alphavbeta5 and beta1 is required for proliferation.
19808644 This study shows that alpha(v)beta(3)-integrin expression on tumor cells actually slows tumor progression and acts as a tumor suppressor.
19808093 Data show that leberagin-C can inhibit the adhesion of melanoma tumour cells on fibrinogen and fibronectin, by interfering with the function of alphavbeta3 and, to a lesser extent, with alphavbeta6 and alpha5beta1 integrins.
19751734 Smooth muscle cell hyperplasia in stricturing Crohn disease is regulated by increased endogenous IGF-I and alphaVbeta3 integrin ligands that regulate augmented proliferation and diminished apoptosis
19710103 upregulated expression in lung adenocarcinoma cells following bacterial infection
19704023 These data are the first demonstration of conformational coupling of the integrin alphaVbeta3 leg and head domains, and suggest that inside-out activation may involve conformational changes other than the postulated switch to a genu-linear state.
19695571 Periostin mediates vascular smooth muscle cell migration through the integrins alphavbeta3 and alphavbeta5 and focal adhesion kinase (FAK) pathway
19617625 Cell adhesion to tropoelastin is mediated via the C-terminal GRKRK motif and integrin alphaVbeta3
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19581046 VEGF is critical to the invasive process in human gastric cancer and that this occurs via up-regulation of integrin alphavbeta6 expression and activation of ERK.
19549907 Tumors express alpha(v)beta(6) suggest that this probe has significant potential for the in vivo detection of the malignancy.
19541645 In metastatic brain lesions carrying activated alpha(v)beta(3), VEGF expression is controlled at the post-transcriptional level and involves phosphorylation and inhibition of translational respressor 4E-binding protein (4E-BP1).
19487690 PAI-1-mediated regulation of alphavbeta3 integrin is critical for the control of TGFbeta signaling and the prevention of fibrotic disease.
19475568 OPN enhances the migration of chondrosarcoma cells by increasing MMP-9 expression through the alphavbeta3 integrin, FAK, MEK, ERK and NF-kappaB signal transduction pathway.
19448673 Results show that alphavbeta6- and alpha5beta1-integrin-dependent activation of Rac1 was mediated through Eps8.
19435649 Down-regulation of alphav integrin by retroviral delivery of siRNA significantly reduced drug resistance of colon tumor cells & xenografts, indicating that ITGAV plays an important role in MCR to oxaliplatin in colon cancer cells.
19371633 These data strongly indicate that KAI1 may suppress ovarian cancer progression by inhibiting integrin alphavbeta3/vitronectin-provoked tumor cell motility and proliferation as important hallmarks of the oncogenic process.
19334037 Data demonstrated significantly upregulated integrin-linked kinase as a function of alphavbeta3 in two ovarian cancer cell lines, and proved co-localization at the surface of alphavbeta3-overexpressing adherent cells.
19267182 Compound 4, having the DGR retro-sequence, is a low micromolar ligand for the alphavbeta5 integrin.
19255147 The active site within the Sdc1 core protein was identified and a peptide inhibitor called synstatin (SSTN) that disrupts Sdc1's interaction with alpha(v)beta(3) and alpha(v)beta(5) integrins was derived.
19212638 In neuroendocrine tumors, gene-expression integrin alphaV was highly variable
19212436 Data show that cilengitide activated cell surface alphaVbeta3, stimulated phosphorylation of FAK, Src and VE-cadherin, increased cell permeability and decreased cell adhesion in endothelial cells.
19164533 data suggest that alphavbeta1 integrin is a functional receptor for hMPV
19141530 data suggest that alpha(v)beta(3) is a key molecule that determines the stimulatory or inhibitory effect of pleiotrophin on cell migration
19118218 pneumococci exploit the vitronectin-alphavbeta3-integrin complex as a cellular receptor for invasion and this integrin-mediated internalization requires the cooperation between the host signalling molecules ILK, PI3K and Akt.
19088289 These data suggest that Coxsackievirus A9 binding to alphaVbeta6 is a high-affinity interaction, which may indicate its importance in clinical infections
19074851 analysis of how the different antiangiogenic potential of resveratrol stereoisomers is related to their different capacity to affect alphavbeta3 integrin function
19061491 in cutaneous nodular melanomas, necrosis was associated with increased tumor thickness, tumor ulceration, vascular invasion, higher tumor proliferation and apoptotic index, increased expression of alphavbeta3 integrin & poor patient outcome
19037107 M6P/IGF2R controls cell invasion by regulating alphaV integrin expression and by accelerating uPAR cleavage, leading to the loss of the urokinase/vitronectin/integrin-binding site on uPAR.
19017937 Analogous to EAE, in subjects with MS, we found increased expression of Opn in DCs and increased expression of the Opn receptors CD44, beta(3), and alpha(v) on T cells.
18927433 VWF strings bind specifically to integrin alpha(v)beta(3) on human endothelial cells
18854176 These results demonstrate that integrin alphavbeta3-mediated transcriptional regulation of MMP-9 and TIMP-1 is critical for suppressing the ovarian cancer cell invasion.
18844213 urokinase-derived antagonists of alphavbeta5 integrin activation inhibit migration and invasion of carcinoma cells
18821851 The apo(a) component of Lp(a) signals through integrin alphaVbeta3 to activate endothelial cells.
18814143 SDF-1alpha enhances the invasiveness of chondrosarcoma cells by increasing alphavbeta3 integrin expression through the CXCR4/ERK/NF-kappaB signal transduction pathway.
18781095 ability of ovarian carcinoma cells to bind to peritoneal mesothelium in vitro and strongly suggest that vitronectin and its receptors contribute to this crucial event.
18698261 overexpressed in endometrial carcinomas, especially with high grade and in lymph node metastases
18695916 Integrin alphavbeta3 is not significantly implicated in the anti-migratory effect of anti-angiogenic urokinase kringle domain
18694400 Observational study of gene-disease association. (HuGE Navigator)
18648521 human umbilical vein endothelial cells adhere to immobilized CXCL4 through alphavbeta3 integrin, and also through other integrins, such as alphavbeta5 and alpha5beta1
18635536 integrins alphavbeta3 and alpha4beta1 may serve as receptors for sPLA2-IIA and mediate pro-inflammatory action of sPLA2-IIA
18550570 Observational study of gene-disease association. (HuGE Navigator)
18549690 osteopontin:alpha(v)beta(3)integrin complex untenable as marker of endometrial receptivity and implantation potential
18451156 Alpha vbeta 6 Integrin promotes the invasion of morphoeic basal cell carcinoma through stromal modulation.
18445685 data identify PAI1 as a novel regulator of fibronectin matrix assembly, and indicate that this regulation occurs through a previously undescribed crosstalk between the alphavbeta5 and alpha5beta1 integrins
18441324 integrin alphavbeta3 binding to FGF1 plays a role in FGF1 signaling
18427826 expression of ITGAV was significantly correlated with differentiation and metastasis of the laryngeal and hypopharyngeal carcinomas; down-regulation of ITGAV gene could inhibit proliferation of Hep-2 cells and induce to its apoptosis.
18394009 significant difference in the expression of the beta(3) integrin subunit between primary glioblastomas compared with low-grade gliomas
18364349 ROCK-dependent actomyosin-driven contractility is a critical determinant for the regulation of the interaction between Necl-5 and integrin alpha(V)beta(3).
18357713 There was significant relationship between integrin alpha-v subunit expression and lymphatic metastasis of laryngeal and hypopharyngeal squamous cell carcinoma.
18353785 results demonstrate that TGFbeta1 induces alphavbeta3 integrin expression via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway
18353318 Infertile women with isolated polycystic ovaries are deficient in endometrial expression of osteopontin but not alphavbeta3 integrin during the implantation window.
18349127 These results suggest that activation of TGF-beta1 by integrin alphavbeta6 contributes to pathological changes and may impair endothelial cell functions in tissues that are chronically infected with cytomegalovirus.
18345483 Data show that in preeclamptic pregnancies, histamine does not stimulate expression of integrin alphaVbeta3, as it does in uncomplicated pergnancies.
18331351 Mn(2+) simultaneously modulates the thiol isomerase activity of protein disulfide isomerase that is bound to alpha(V)beta(3) and induces its transition to the ligand-competent state, suggesting an alternative mechanism of integrin regulation
18310446 T(3) and T(4) hormones rapidly stimulate ERK activation in MG-63 cells via integrin alpha(V)beta(3) and that one functional effect of this ERK activation is increased DNA synthesis
18310319 The shear-induced G(2)/M arrest and corresponding changes in G(2)/M regulatory protein expression and activity were mediated by alpha(v)beta(3) and beta(1) integrins through bone morphogenetic protein receptor type IA-specific Smad1 and Smad5.
18247041 Integrin alpha v beta 3 plays a critical role in the S1P-stimulated chemotactic response of ECs
18227168 The role of alpha(v)beta(3) and Fas as the mediators of streptococcal pyrogenic exotoxin (SPE) B-induced apoptosis is described.
18221819 Integrin alphavbeta6 is induced de novo in rodent and human liver fibrosis, where it is expressed on activated bile duct epithelia and (transitional) hepatocytes during fibrosis progression.
18211678 We used suppression subtractive hybridization (SSH) to study molecular signature of melanoma progression, by showing characteristics of early neoplastic lesions including expression of KISS1, lack of alphavbeta3-integrin and low levels of RHOC.
18191107 TGF-beta1 acts through PI3K/Akt, which in turn activates IKKalpha/beta and NF-kappaB, resulting in the activations of alphavbeta3 integrins and contributing the migration of chondrosarcoma cells
18090124 Alpha v beta 5, alpha v beta 5 and their ligands Del-1 and L1 play an important role in the process of tumor cells moving from the original place.
18084301 uPAR is required to activate alphavbeta3 integrin in podocytes, promoting cell motility and activation of the small GTPases Cdc42 and Rac1
18079201 Signal transduction pathways underlying the enhanced cell migration reveal that the IGF-I-IGFBP-VN complex stimulates a transient activation of the ERK/MAPK signaling pathway and a sustained activation of the phosphatidylinositide 3-kinase/AKT pathway.
18064530 anti-tumor and anti-metastatic activities of CNTO 95 in breast cancer models and provide insight into the cellular and molecular mechanisms mediating its inhibitory effects on metastasis.
18062611 Report observed that alphav-beta3 integrins and Focal Adhesion Protein-Tyrosine Kinases co-localize and that fibrillin filament attachment sites to endothelial cells merge with these molecules.
18045938 the studies demonstrate that Vbeta3 is a cellular receptor mediating both the cell adhesion and entry of KSHV into target cells through binding the virion-associated gB(RGD).
17965016 Results show that the tyrosine phosphatase protein-tyrosine phosphatase mu dephosphorylated PIPKIgamma and thus canceled the PIPKIgamma-dependent activation of integrin alpha(v)beta(3) by blocking the interaction of integrin alpha(v)beta(3) with talin.
17879163 These findings provide evidence that mutations in fibronectin, induce anoikis in human squamous cell carcinoma cells by modulating integrin alpha v-mediated phosphorylation of FAK and ERK.
17854909 macrophage migration inhibitory factor directly up-regulates alphavbeta3 integrin and VEGF expression in human endometrial Ishikawa cells
17641225 c-Src controls functional association between integrin alphav-beta3 and VEGFR-2 via integrin beta3 phosphorylation.
17621633 establishes alphavbeta3 integrin as one key component of the transendothelial migration process of tumor cells, and as a potential target for anti-metastatic therapy
17615072 The rs3738919-C allele of the ITGAV gene is associated with rheumatoid arthritis in the European Caucasian population, suggesting ITGAV as a new minor susceptibility gene for rheumatoid arthritis.
17615072 Observational study of gene-disease association. (HuGE Navigator)
17550972 Results suggest that CTGF plays a crucial role in migratory/invasive processes in human breast cancer by a mechanism involving activation of the integrin-alphavbeta3-ERK1/2-S100A4 pathway.
17483236 Endothelial cell integrin alphaV beta3 is involved in sickle cell red blood cell adhesion.
17446174 Necl-5 has a critical role in integrin alphavbeta3 clustering and focal complex formation
17408468 Observational study of gene-disease association. (HuGE Navigator)
17369840 Prostate cancer cells expressing fully functional but not dysregulated alphavbeta3 integrin are able to control their own adherence and migration to bone matrix, functions that facilitate tumor growth and control bone lesion development.
17331499 Adhesion of breast cancer cells through the VLA integrins alpha2beta1 and alpha5beta1 was significantly reduced by an apoptosis-inducing natural triterpenoid, dehydrothyrsiferol (DT), when studied on low amounts of extracellular matrix.
17300927 integrins alpha5beta1 and alphaV are inhibited by lebectin and lebecetin snake venom lectins
17275949 Mn(2+) promoted convergent changes in integrin alphavbeta6 conformation and Fb structure through activation of ERK/MAPK and MMP-9
17175151 type I collagen induction of MT1-MMP-mediated MMP-2 activation is repressed by alphaVbeta3 integrin in human breast cancer cells
17158881 identifies integrin alphaVbeta6 as a novel cellular receptor for fibrillin-1 with a K(d) of approximately 0.45 mum
17034033 The transition from a locally invasive phenotype to a metastatic phenotype may be primed by the elevated expression of alpha(v)beta(3) receptors in prostate cancer cells.
16973584 integrin binding loop of Foot-and-mouth disease virus has most likely evolved for binding to alphavbeta6 with a higher affinity than to alphavbeta3 and alphavbeta8
16947382 Relevance of betaIG-H3 and alpha v beta3 integrin-interacting motifs as potential therapeutic targets in rheumatoid arthritis.
16877343 These findings elucidate the function and complex regulation of integrin-mediated activation of TGF-beta within the epithelial-mesenchymal trophic unit (EMTU).[integrin alphavbt=eta6, integrin alphavbeta8]
16835373 S 36578-2 is highly selective for alpha v beta3 and alpha v beta5 integrins and induces detachment, caspase-8 activation, and apoptosis in human umbilical endothelial cells
16818691 PET Molecular imaging of alpha(v)beta3 expression with [18F]Galacto-RGD in humans correlates with alpha(v)beta3 expression as determined by immunohistochemistry.
16790523 binding of resveratrol to integrin alphaVbeta3, principally to the beta3 monomer, is essential for transduction of the stilbene signal into p53-dependent apoptosis of breast cancer cells.
16731529 integrin alpha3beta1 is a receptor for the alpha3NC1 domain and transdominantly inhibits integrin alphavbeta3 activation
16702213 periostin has an active role in the epithelial-mesenchymal transformation and metastasis that requires cross-talk between integrin and EGFR signaling pathways
16675963 upregulated expression of alphavbeta5 contributes to autocrine TGF-beta signaling in localized scleroderma fibroblasts
16672769 Alphavbeta5 integrin may play a role in the adhesion and migration of VSMCs during the pathogenesis of atherosclerosis.
16631833 The effects of the EBV nuclear antigen 3C on the activities of Nm23-H1 via GATA-1 and Sp1 are reported.
16631740 Findings suggest that in melanoma cells the increase in MMP-2 activity, CD44 surface expression, and cell migration is integrin alpha V-dependent.
16614246 While tolerogenic DCs are not induced via alphavbeta5, coligation of CR3 and alphavbeta5 maintains the DC's tolerogenic profile.
16496302 thymosin beta10, but not thymosin beta4, have direct inhibitive effects on endothelial migration and tube formation that might be mediated via downregulation of VEGF, VEGFR-1 and integrin alphaV in HCAECs.
16448724 These results indicate that the alpha2beta1 and alphaVbeta1 integrin signaling pathway may be critical components of neurodegeneration in Alzheimer's disease.
16407244 cardiotoxin A5 binds to alpha(v)beta3 integrin and inhibits bone resorption
16400188 the signal interaction between IGF-1R and alpha(v)beta3 integrin plays an important role in promoting the development and progression of cervical cancer
16385340 Expression of integrins alphavbeta1, alphavbeta3, and alphavbeta5 in cerebral arteriovenous malformations and cavernous malformations. (Integrins alphavbeta1, alphavbeta3, and alphavbeta5)
16186116 the RGD-dependent interaction between the P2Y(2)R and alpha(v) integrins is necessary for the P2Y(2)R to activate G(o) and to initiate G(o)-mediated signaling events leading to chemotaxis
16166568 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
16150802 alphavbeta3 integrin is transiently up-regulated (and activated) in graft arteriopathy
16105876 Data show that alpha(v)beta3/Tat interaction triggers the activation of NF-kappaB in endothelial cells in a focal adhesion kinase-, RhoA- and pp60src-dependent manner, and this activation is required for motogenic activity of Tat in endothelial cells.
16105876 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
16100012 Increased transcripts of activators of TGFB1 (Itgav and Thbs1), and genes that are activated by TGFB1 (Spp1, Timp1, and Tnc) occurs during acute lung injury
16024014 Alphavbeta6 integrin down-regulates MMP-13 expression in oral squamous cell carcinoma cells.
16005200 integrin alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 binding to osteopontin is controlled by specific structural motifs that are recognized by extracellular proteases
15998788 melanoma cells cross-present, in an alpha v beta3-dependent manner, an antigen derived from secreted matrix metalloproteinase-2 (MMP-2) to human leukocyte antigen A*0201-restricted T cells
15925879 May contribute to the formation of arteriovenous malformaions in younger patients.
15921657 Gal3ST-2 is involved in tumor metastasis process by regulation of adhesion ability to selectins and expression of integrin alphaV but not beta3
15914035 IGROV1 cells were shown to adhere rapidly on the HUVECs monolayer; adhesion was inhibited by anti-alphav integrin and anti-Vn blocking antibodies, but not by anti-beta1 integrin antibodies
15897908 new pair of adhesion molecules, Thy-1 and alphavbeta3, inditified that mediate the interaction of melanoma cells and activated endothelial cells
15866865 urokinase receptor-derived SRSRY peptide regulates cross-talk between fMLP and vitronectin receptors
15834425 Epidermal growth factor receptor and alphavbeta3 work together as coreceptors for Human cytomegalovirus entry and signaling.
15828940 We conclude that integrin alphavbeta6-dependent MMP-2 and -9 up-regulation is an important feature of increased migration in hypoxic human keratinocytes.
15795319 We conclude that the ectodomain of alphaVbeta3 manifests a bent conformation that is capable of stably binding a physiological ligand in solution.
15695828 Pyk2 is a phosphorylated beta(3) binding partner, providing a potential structural and signaling platform to achieve alpha(V)beta(3) -mediated remodeling of the actin cytoskele
15647827 BMP-2 upregulates the expression of alphavbeta integrins, and these integrins, in turn, play a critical role in BMP-2 function in osteoblasts
15638730 The Integrin alphaV receptor is members of the group of the cellular adhesion molecules (CAM), are heterodimeric transmembrane glycoprotein receptors involved in processes such as cell-cell and cell-matrix adhesion, cell migration and signaling.
15609323 alphav integrins and MMP2 have roles in migration of human ovarian adenocarcinoma cells through endothelial extracellular matrix
15557124 Integrin alphav controls melanoma cell survival in 3D-collagen through a pathway involving p53 regulation of MEK1 signaling.
15509546 CEACAM1 and alpha(v)beta(3) integrin are functionally interconnected with respect to the invasive growth of melanomas
15299032 secondary structure analysis of integrin alphaVbeta3
15269586 alpha-v integrin signals through JAB1 (Jun activation binding protein 1) to prolong MMP1 production
15194773 integrin alpha(v)beta(6) is an RGD-dependent receptor for Coxsackievirus A9 and may be important in natural Coxsackievirus A9 infections
15051489 Role of alpha4, alpha5, and alphav integrin receptors--which are central to mediating interactions with these domains of FN--in regulating ssquamous cell carcinoma migration.
15044441 alphavbeta3 integrin has a role in regulating proliferation and apoptosis of hepatic stellate cells
14966135 CD47-alpha(v)beta(3) interactions that lead to integrin clustering are detergent resistant and do not require cholesterol or the transmembrane region of CD47
14766759 alpha(v)beta(1) supports fetal beta-cell migration and could play an important role in early motile processes required for islet neogenesis
14741360 alphav subunit cleavage is essential for integrin function and has a considerable impact on integrin-dependent events, especially those leading to cell migration
14666169 alpha3beta1, alpha4beta1 and alphaVbeta1 integrins may play an important role in the implantation process
14596610 Disulfide bonding patterns of the integrin alpha V chain are described; the alpha chain displays differences in the disulfide patterns of those bonds near their C-terminal regions linking the heavy and light chains.
14524530 integrin alpha(v)beta3 has an important role in bone metabolism and angiogenesis, and in controlling growth of metastatic prostate cancer cells in the bone
12893184 AlphaV- and beta1-integrin subunits are commonly expressed in malignant effusions from ovarian carcinoma patients.
12875973 These data provide evidence for a functional role for integrin alphavbeta8-mediated activation of transforming growth factor-beta in control of human airway epithelial proliferation in vivo.
12874388 integrin alphavbeta3 cooperates with metalloproteinase MMP-9 in regulating migration of metastatic breast cancer cells
12807887 alpha 5 beta 1 and alpha v beta 3 are both important but cell-specific fibrillin-1 receptors
12765524 Data provide the first evidence that alphavbeta3 integrin can generate apoptosis-stimulating signals.
12750158 signaling through JAM-1 and alphavbeta3 is necessary for bFGF-induced angiogenesis.
12691260 Data suggest that this alphavbeta3 binding to alpha5-laminins is involved in the regulation of cellular responses to growth factors known to be involved in epithelial and endothelial development.
12682293 tumstatin binds to alpha v beta 3 integrin in a vitronectin/fibronectin/RGD cyclic peptide independent manner
12660257 Alphavbeta3 integrin expression and pinopode formation in human endometrium are processes closely related to endometrial maturation; unlikely as targets for contraceptive approaches or fertility-promoting strategies
12645863 decreased expression of endometrial integrin alphavbeta3 suggests that functional, but not morphological, endometrial defect may be one of the causes for the patients with unexplained infertility and recurrent IVF-ET failures
12642872 role in regulating cell proliferation through integrin-linked kinase (ILK) in ovarian cancer cells
12639965 thymidine phosphorylase and 2-deoxyribose-induced focal adhesion kinase phosphorylation was blocked by the antibodies to integrins alpha 5 beta 1 and alpha v beta 3, directly linking their migration and signaling components
12553378 has a role in the early phase of liver metastasis
12486108 integrin alpha5beta1-mediated control of the levels of integrin alphaVbeta3 is important for the distribution of focal contacts
12427871 Data show a novel mechanism by which ECM regulates membrane-type 1 matrix metalloproteinase (MT1-MMP) association with beta1 or alphavbeta3 integrins, thus modulating its internalization, activity, and function on human endothelial cells.
12399420 activation state of alphaVbeta3 integrin is an important regulator of the duration of insulin-like growth factor I receptor phosphorylation and this regulation is mediated through changes in the subcellular localization of SHP-2
12384999 Overexpression of integrin alphaV promotes human osteosarcoma cell populated collagen lattice contraction and cell movement.
12372811 thrombin interacts with alphavbeta3 as demonstrated by direct binding of alphavbeta3 protein to immobilized thrombin.
12372469 in patients with endometriosis a significant negative correlation was observed between luminal expression of eNOS and alpha(v)beta(3) integrin and between glandular expression of eNOS and luminal expression of alpha(v)beta(3) integrin
12370491 An autocrine loop of the integrin alpha(V)beta(3)/CD47 receptor complex and thrombospondin-1 is identified as the molecular coupling device between mechanical loading and apoptosis.
12364323 role in mediating pro-angiogenic activity of CYR61
12358597 Data show clearly that integrin alpha(v)beta(3) interacts with the latency-associated peptide (LAPbeta1 and 3) RGD motif.
12324470 identification of functional segments within the beta2I-domain
12324452 induced alpha(v)beta(8) integrin expression mediated Fas-stimulated migration
12270930 identification of a new alphavbeta5 integrin-interacting motif that is highly conserved in the fas-1 domains of many proteins suggesting that fas-1 domain-containing proteins may perform their biological functions by interacting with integrins
12237321 promotion of integrin alpha Vbeta 3-dependent endothelial cell adhesion by PGE2
12237112 phosphoinositide 3-kinase C2alpha was found to be differentially regulated by alpha(v)beta(3) engagement
12210725 alpha v beta 3 integrin signaling through Shc recruitment in response to mechanical stimulation in human osteoblasts
12198771 Integrin alphavbeta3. Expression of integrin alpha v beta 3 promotes the metastatic phenotype in human melanoma by supporting specific adhesive, invasive and migratory properties of the tumor cells
12168086 integrin alphaVbeta3 expression is reduced when ROR alpha is activated in prostate cancer cells
12161360 Alpha(v)beta(3) integrin engagement enhances cell invasiveness in human multiple myeloma.
12143051 existence of an alpha V integrin/vitronectin connection in hepatocellular carcinoma and suggest that this connection may be an adverse prognostic factor.
12099514 Acute cellular rejection following human heart transplantation is associated with increased expression
12083833 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
12031826 Factor XIII mediates adhesion of platelets to endothelial cells through alpha(v)beta(3) and glycoprotein IIb/IIIa integrins.
11959660 Del1 mediates vascular smooth muscle cell adhesion, migration, and proliferation through interaction with integrin alpha(v)beta(3).
11934894 Unique ability of integrin alpha(v)beta 3 to support tumor cell arrest under dynamic flow conditions (Integrin alpha-v beta-3)
11928818 Chemotaxis and chemoinvasion analyses revealed a dose-dependent increase in prostate cancer cell movement induced by osteopontin and a strict dependence of cell invasion on alphavbeta3 integrin function.
11872628 They analyzed the expression of these cell surface receptors in nine ovarian cancer cell lines and also in the primary human ovarian surface epithelial cell line (HOSE).
11858476 Review. Alpha(v)beta3 integrins are involved in vascular repair processes. The challenge is to develop a therapeutic agent that will prove effective in reducing restenosis in humans following percutaneous coronary intervention (PCI).
11848444 Acute hyperglycaemia induces an up-regulation of seven major genes, four of which were not previously reported in the literature. Northern blot analyses, performed on these 4 genes, confirm macroarrays results for alphav, beta4, c-myc, and MUC18.
11724803 Processing of integrin alpha(v) subunit by membrane type 1 matrix metalloproteinase stimulates migration of breast carcinoma cells on vitronectin
10982404 integrin alphavbeta3 is shown to interact with PECAM-1
10438928 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
10397733 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
9916748 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
9626063 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
9517988 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
9256940 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
8757349 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
7690138 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
7682219 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
7539135 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins
2202737 HIV-1 Tat complexes with gp120 to induce entry of VLPs expressing R5- or X4-tropic Env into MDDCs, which involves alpha5beta1, alpha5beta3, and alpha5beta5 integrins

AA Sequence

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGA      1 - 70
PKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAP     71 - 140
LYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ    141 - 210
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL    211 - 280
GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ    281 - 350
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI    351 - 420
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKT    421 - 490
CSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRG    491 - 560
GLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN    561 - 630
VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF    631 - 700
KTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLA    701 - 770
AVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY    771 - 840
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCL    841 - 910
KIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN    911 - 980
VTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET      981 - 1048
//

Text Mined References (490)

PMID Year Title
26901152 2016 Stromal cells control the epithelial residence of DCs and memory T cells by regulated activation of TGF-?.
26663660 2016 Stable Peptides Instead of Stapled Peptides: Highly Potent ?v?6-Selective Integrin Ligands.
26334633 2015 Enhanced Expression of Integrin ?v?3 Induced by TGF-? Is Required for the Enhancing Effect of Fibroblast Growth Factor 1 (FGF1) in TGF-?-Induced Epithelial-Mesenchymal Transition (EMT) in Mammary Epithelial Cells.
26222911 2015 Interactions between ?v-Integrin and HER2 and Their Role in the Invasive Phenotype of Breast Cancer Cells In Vitro and in Rat Brain.
26165836 2016 The thyroid hormone-?v?3 integrin axis in ovarian cancer: regulation of gene transcription and MAPK-dependent proliferation.
26157134 2015 Dissociation of HSV gL from gH by ?v?6- or ?v?8-integrin promotes gH activation and virus entry.
25982998 2015 Integrin ?6 can be translationally regulated by eukaryotic initiation factor 4E: Contributing to colonic tumor malignancy.
25900259 2015 Periostin of human periodontal ligament fibroblasts promotes migration of human mesenchymal stem cell through the ?v?3 integrin/FAK/PI3K/Akt pathway.
25889845 2015 Involvement of ROS-alpha v beta 3 integrin-FAK/Pyk2 in the inhibitory effect of melatonin on U251 glioma cell migration and invasion under hypoxia.
25862865 2015 Aberrant glycosylation of ?v?3 integrin is associated with melanoma progression.
25858144 2015 miR-25 Modulates Invasiveness and Dissemination of Human Prostate Cancer Cells via Regulation of ?v- and ?6-Integrin Expression.
25857463 2015 Colorectal Cancer Metastases Settle in the Hepatic Microenvironment Through ?5?1 Integrin.
25849225 2015 Genetic depletion and pharmacological targeting of ?v integrin in breast cancer cells impairs metastasis in zebrafish and mouse xenograft models.
25749383 2015 Osteopontin promotes a cancer stem cell-like phenotype in hepatocellular carcinoma cells via an integrin-NF-?B-HIF-1? pathway.
25745053 2015 ?v?6 integrin may be a potential prognostic biomarker in interstitial lung disease.
25663698 2015 The integrin expression profile modulates orientation and dynamics of force transmission at cell-matrix adhesions.
25604835 2015 Integrin binding by Borrelia burgdorferi?P66 facilitates dissemination but is not required for infectivity.
25572981 2015 Integrin ?v?3 is required for cathepsin B-induced hepatocellular carcinoma progression.
25497015 2015 Osteopontin-integrin ?(v)?(3) axis is crucial for 5-fluorouracil resistance in oral squamous cell carcinoma.
25488971 2015 Integrin ?v?3 acting as membrane receptor for thyroid hormones mediates angiogenesis in malignant T cells.
25398877 2015 Proinflammatory secreted phospholipase A2 type IIA (sPLA-IIA) induces integrin activation through direct binding to a newly identified binding site (site 2) in integrins ?v?3, ?4?1, and ?5?1.
25370835 2015 Integrin ?v promotes proliferation by activating ERK 1/2 in the human lung cancer cell line A549.
25320004 2014 ?v?6 Expression in myoepithelial cells: a novel marker for predicting DCIS progression with therapeutic potential.
25318615 2014 Characterization of the interaction between heterodimeric ?v?6 integrin and urokinase plasminogen activator receptor (uPAR) using functional proteomics.
25290158 2014 Peptides derived from central turn motifs within integrin ?IIb and ?V cytoplasmic tails inhibit integrin activation.
25277122 2014 Interaction of platelet-derived autotaxin with tumor integrin ?V?3 controls metastasis of breast cancer cells to bone.
25275062 2014 Overexpression of the ITGAV gene is associated with progression and spread of colorectal cancer.
25273699 2014 Elevated autocrine EDIL3 protects hepatocellular carcinoma from anoikis through RGD-mediated integrin activation.
25263164 2014 Nicotinamide phosphoribosyltransferase can affect metastatic activity and cell adhesive functions by regulating integrins in breast cancer.
25249331 2015 Inhibition of tumor-associated ?v?3 integrin regulates the angiogenic switch by enhancing expression of IGFBP-4 leading to reduced melanoma growth and angiogenesis in vivo.
25193465 2014 Cyclin D1b splice variant promotes ?v?3-mediated adhesion and invasive migration of breast cancer cells.
25190218 2014 Overexpression of integrin ?v facilitates proliferation and invasion of oral squamous cell carcinoma cells via MEK/ERK signaling pathway that is activated by interaction of integrin ?v?8 with type ? collagen.
25174803 2014 Effects of integrin ???3 on differentiation and collagen synthesis induced by connective tissue growth factor in human hypertrophic scar fibroblasts.
25150423 2014 ?v?3, ?v?5 and ?v?6 integrins in brain metastases of lung cancer.
25150077 2014 The ITGAV-rs3911238 polymorphism is associated with disease activity in rheumatoid arthritis.
25117682 2014 Integrin ?v?3 drives slug activation and stemness in the pregnant and neoplastic mammary gland.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
24942591 2014 Herpes simplex virus type 2 glycoprotein H interacts with integrin ?v?3 to facilitate viral entry and calcium signaling in human genital tract epithelial cells.
24939290 2014 Effects of integrins and integrin ?v?3 inhibitor on angiogenesis in cerebral ischemic stroke.
24789099 2014 The chemokine fractalkine can activate integrins without CX3CR1 through direct binding to a ligand-binding site distinct from the classical RGD-binding site.
24785587 2014 Regulation of ionizing radiation-induced adhesion of breast cancer cells to fibronectin by alpha5beta1 integrin.
24737780 2014 Angiomodulin, a marker of cancer vasculature, is upregulated by vascular endothelial growth factor and increases vascular permeability as a ligand of integrin ?v?3.
24737028 2014 Dual targeting of integrin ?v?3 and matrix metalloproteinase-2 for optical imaging of tumors and chemotherapeutic delivery.
24699825 2014 PAR-3 knockdown enhances adhesion rate of PANC-1 cells via increased expression of integrin?v and E-cadherin.
24695839 2014 Overexpression of integrin ?v correlates with poor prognosis in colorectal cancer.
24690239 2014 Prospective assessment of midsecretory endometrial leukemia inhibitor factor expression versus ???3 testing in women with unexplained infertility.
24658351 2014 Structural basis for pure antagonism of integrin ?V?3 by a high-affinity form of fibronectin.
24639195 2014 Integrins ?v?5 and ?v?3 promote latent TGF-?1 activation by human cardiac fibroblast contraction.
24573955 2014 Suppression of Hedgehog signalling promotes pro-tumourigenic integrin expression and function.
24515920 2014 Cilengitide, a small molecule antagonist, targeted to integrin ?? inhibits proliferation and induces apoptosis of laryngeal cancer cells in vitro.
24498405 2014 OPN and ?v?3 expression are predictors of disease severity and worse prognosis in hepatocellular carcinoma.
24478423 2014 Roles of the putative integrin-binding motif of the human metapneumovirus fusion (f) protein in cell-cell fusion, viral infectivity, and pathogenesis.
24464580 2014 CCN2 suppresses catabolic effects of interleukin-1? through ?5?1 and ?V?3 integrins in nucleus pulposus cells: implications in intervertebral disc degeneration.
24424369 2014 Role for the endometrial epithelial protein MFG-E8 and its receptor integrin ?v?3 in human implantation: results of an in vitro trophoblast attachment study using established human cell lines.
24412187 2014 PET/CT imaging of integrin ?v?3 expression in human carotid atherosclerosis.
24389192 2014 Alpha(v)beta5 integrins mediates Pseudomonas fluorescens interaction with A549 cells.
24375314 2014 The rs3768777-G allele of ITGAV gene is associated with rheumatoid arthritis.
24367260 2013 ?v?6- and ?v?8-integrins serve as interchangeable receptors for HSV gH/gL to promote endocytosis and activation of membrane fusion.
24363825 2013 Transient limb ischemia alters serum protein expression in healthy volunteers: complement C3 and vitronectin may be involved in organ protection induced by remote ischemic preconditioning.
24294359 2013 Comparing the expression of integrins ?v?3, ?v?5, ?v?6, ?v?8, fibronectin and fibrinogen in human brain metastases and their corresponding primary tumors.
24150233 2014 Altered microenvironment promotes progression of preinvasive breast cancer: myoepithelial expression of ?v?6 integrin in DCIS identifies high-risk patients and predicts recurrence.
24023288 2013 High lung-metastatic variant of human osteosarcoma cells, selected by passage of lung metastasis in nude mice, is associated with increased expression of ?(v)?(3) integrin.
24011356 2013 Identification of novel integrin binding partners for calcium and integrin binding protein 1 (CIB1): structural and thermodynamic basis of CIB1 promiscuity.
23992637 2014 Osteopontin is associated with decreased apoptosis and ?v integrin expression in lung adenocarcinoma.
23898055 2013 Real-time imaging of ?v integrin molecular dynamics in osteosarcoma cells in vitro and in vivo.
23845726 2013 CCL2 increases ?v?3 integrin expression and subsequently promotes prostate cancer migration.
23845472 2013 The ?5/focal adhesion kinase/glycogen synthase kinase 3? integrin pathway in high-grade osteosarcoma: a protein expression profile predictive of response to neoadjuvant chemotherapy.
23840404 2013 Epitope mapping for monoclonal antibody reveals the activation mechanism for ?V?3 integrin.
23821196 2013 Activated ?v?3 integrin regulates ?v?5 integrin-mediated phagocytosis in trabecular meshwork cells.
23776077 2013 PDGFR? and CD51 mark human nestin+ sphere-forming mesenchymal stem cells capable of hematopoietic progenitor cell expansion.
23744557 2013 Interaction of CCN1 with ?v?3 integrin induces P-glycoprotein and confers vinblastine resistance in renal cell carcinoma cells.
23726972 2013 Apolipoprotein(a) acts as a chemorepellent to human vascular smooth muscle cells via integrin ?V?3 and RhoA/ROCK-mediated mechanisms.
23725446 2013 Expression of Lewis y antigen and integrin ?v, ?3 in ovarian cancer and their relationship with chemotherapeutic drug resistance.
23722547 2013 Vitronectin-?v?3 integrin engagement directs hypoxia-resistant mTOR activity and sustained protein synthesis linked to invasion by breast cancer cells.
23704872 2013 Glioma initiating cells form a differentiation niche via the induction of extracellular matrices and integrin ?V.
23658209 2013 Integrins modulate the infection efficiency of West Nile virus into cells.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23618859 2013 A novel anti-CCN1 monoclonal antibody suppresses Rac-dependent cytoskeletal reorganization and migratory activities in breast cancer cells.
23615713 2013 Stromal cell-derived factor-1 (SDF-1) enhances cells invasion by ?v?6 integrin-mediated signaling in ovarian cancer.
23544955 2013 An aptamer-siRNA chimera silences the eukaryotic elongation factor 2 gene and induces apoptosis in cancers expressing ?v?3 integrin.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23462327 2013 The differentiation of pancreatic tumor-initiating cells by vitronectin can be blocked by cilengitide.
23412966 2013 Integrin alpha v beta 6 contributes to maintaining corneal epithelial barrier function.
23399898 2013 Longitudinal expression analysis of ?v integrins in human gliomas reveals upregulation of integrin ?v?3 as a negative prognostic factor.
23386126 2013 EGFL7 ligates ?v?3 integrin to enhance vessel formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23331428 2013 Expression of ?v?6 integrin and collagen fibre in oral squamous cell carcinoma: association with clinical outcomes and prognostic implications.
23283986 2013 ?v?8 integrin interacts with RhoGDI1 to regulate Rac1 and Cdc42 activation and drive glioblastoma cell invasion.
23269786 2013 Integrin and defensin modulate the mechanical properties of adenovirus.
23261238 2013 Elevated expression of integrin ?v and ?5 subunit in laryngeal squamous-cell carcinoma associated with lymphatic metastasis and angiogenesis.
23238957 2013 Expression of integrins ?v?3 and ?v?5 and their ligands in primary and secondary central nervous system neoplasms.
23227240 2012 CTGF increases IL-6 expression in human synovial fibroblasts through integrin-dependent signaling pathway.
23204516 2013 Cathepsin H mediates the processing of talin and regulates migration of prostate cancer cells.
23181508 2012 RGD binding to integrin alphavbeta3 affects cell motility and adhesion in primary human breast cancer cultures.
23161541 2013 Interplay between ?v?3 integrin and nucleolin regulates human endothelial and glioma cell migration.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23150579 2012 ?v?3-integrin is a major sensor and activator of innate immunity to herpes simplex virus-1.
23128103 2013 Relationship between the expression of the extracellular matrix genes SPARC, SPP1, FN1, ITGA5 and ITGAV and clinicopathological parameters of tumor progression and colorectal cancer dissemination.
23125415 2012 Integrins ?v?3 and ?4?1 act as coreceptors for fractalkine, and the integrin-binding defective mutant of fractalkine is an antagonist of CX3CR1.
23119061 2012 Overexpression of osteopontin, ?v?3 and Pim-1 associated with prognostically important clinicopathologic variables in non-small cell lung cancer.
23106217 2012 ?(V)?(3) integrin crystal structures and their functional implications.
23053782 2013 Involvement of ?v?3 integrin in gremlin-induced angiogenesis.
23028753 2012 Saccharomyces boulardii improves intestinal epithelial cell restitution by inhibiting ?v?5 integrin activation state.
23022044 2012 Anti-angiogenic effects of thioridazine involving the FAK-mTOR pathway.
22975325 2012 PKD controls ?v?3 integrin recycling and tumor cell invasive migration through its substrate Rabaptin-5.
22966907 2012 Integrin ?v?3 and CD44 pathways in metastatic prostate cancer cells support osteoclastogenesis via a Runx2/Smad 5/receptor activator of NF-?B ligand signaling axis.
22879933 2012 c-Abl is an upstream regulator of acid sphingomyelinase in apoptosis induced by inhibition of integrins ?v?3 and ?v?5.
22837212 2012 Epstein-Barr virus latent membrane protein-2A induces ITAM/Syk- and Akt-dependent epithelial migration through ?v-integrin membrane translocation.
22787119 2012 TGF-? and ?v?6 integrin act in a common pathway to suppress pancreatic cancer progression.
22721769 2012 An angiogenic role for the ?5?1 integrin in promoting endothelial cell proliferation during cerebral hypoxia.
22719931 2012 ?V integrin induces multicellular radioresistance in human nasopharyngeal carcinoma via activating SAPK/JNK pathway.
22710795 2012 FAS1 domain protein inhibits VEGF165-induced angiogenesis by targeting the interaction between VEGFR-2 and ?v?3 integrin.
22659470 2012 Highly invasive melanoma cells activate the vascular endothelium via an MMP-2/integrin ?v?5-induced secretion of VEGF-A.
22614033 2012 N-acetylglucosaminyltransferase V negatively regulates integrin ?5?1-mediated monocyte adhesion and transmigration through vascular endothelium.
22566688 2012 Cross talk between engulfment receptors stabilin-2 and integrin ?v?5 orchestrates engulfment of phosphatidylserine-exposed erythrocytes.
22547930 2012 Combined QM/MM study of thyroid and steroid hormone analogue interactions with ?v?3 integrin.
22505472 2012 Exosome release of ADAM15 and the functional implications of human macrophage-derived ADAM15 exosomes.
22469980 2013 Death inducer-obliterator 1 (Dido1) is a BMP target gene and promotes BMP-induced melanoma progression.
22308022 2012 Unique disulfide bonds in epidermal growth factor (EGF) domains of ?3 affect structure and function of ?IIb?3 and ?v?3 integrins in different manner.
22174124 2012 Macrophage migration inhibitory factor increases cell motility and up-regulates ?v?3 integrin in human chondrosarcoma cells.
22132110 2011 Crosstalk between integrin ?v?3 and estrogen receptor-? is involved in thyroid hormone-induced proliferation in human lung carcinoma cells.
22110279 2011 ?v integrin: a new gastrin target in human pancreatic cancer cells.
22094875 2012 ATM-mediated DNA damage signals mediate immune escape through integrin-?v?3-dependent mechanisms.
22081516 2012 Mapping of homozygous deletions in verified esophageal adenocarcinoma cell lines and xenografts.
22081074 2012 PTTG induces EMT through integrin ?V?3-focal adhesion kinase signaling in lung cancer cells.
21978494 2011 Targeting ???3 and ???5 inhibits photon-induced hypermigration of malignant glioma cells.
21957301 2011 Fusion of Epstein-Barr virus with epithelial cells can be triggered by ?v?5 in addition to ?v?6 and ?v?8, and integrin binding triggers a conformational change in glycoproteins gHgL.
21853313 2011 Overexpression of osteopontin and integrin ?v in laryngeal and hypopharyngeal carcinomas associated with differentiation and metastasis.
21787362 2011 ?v integrin processing interferes with the cross-talk between ?v?5/?6 and ?2?1 integrins.
21764795 2011 Novel (64)Cu- and (68)Ga-labeled RGD conjugates show improved PET imaging of ?(?)?(3) integrin expression and facile radiosynthesis.
21752283 2011 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21748756 2012 Prostate cancer targeting motifs: expression of ?? ?3, neurotensin receptor 1, prostate specific membrane antigen, and prostate stem cell antigen in human prostate cancer cell lines and xenografts.
21712047 2011 Increased expression of the coxsackie and adenovirus receptor downregulates ?v?3 and ?v?5 integrin expression and reduces cell adhesion and migration.
21677875 2011 Targeting of ?(v)-integrins in stem/progenitor cells and supportive microenvironment impairs bone metastasis in human prostate cancer.
21646718 2011 Mouse and human lung fibroblasts regulate dendritic cell trafficking, airway inflammation, and fibrosis through integrin ?v?8-mediated activation of TGF-?.
21590707 2011 IL-8 increases integrin expression and cell motility in human chondrosarcoma cells.
21530503 2011 Fibroblast expression of ?-smooth muscle actin, ?2?1 integrin and ?v?3 integrin: influence of surface rigidity.
21433063 2011 Integrin ?v?3 promotes vitronectin gene expression in human ovarian cancer cells by implicating rel transcription factors.
21427239 2011 Contact by melanoma cells causes malignant transformation of human epithelial-like stem cells via alpha V integrin activation of transforming growth factor ?1 signaling.
21425129 2011 ?v?5 integrin promotes dedifferentiation of monolayer-cultured articular chondrocytes.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21379327 2011 Molecular dynamics simulations of forced unbending of integrin ?(v)??.
21375561 2011 Analysis of ?v integrin protein expression in human eyelid and periorbital squamous cell carcinomas.
21352421 2011 S100A4 protects gastric cancer cells from anoikis through regulation of ?v and ?5 integrin.
21347514 2011 Chemokine receptor 7 promotes cell migration and adhesion in metastatic squamous cell carcinoma of the head and neck by activating integrin ?v?3.
21344378 2011 CCN3 increases cell motility and MMP-13 expression in human chondrosarcoma through integrin-dependent pathway.
21321268 2011 Monitoring tumor response to antiangiogenic sunitinib therapy with 18F-fluciclatide, an 18F-labeled ?Vbeta3-integrin and ?V beta5-integrin imaging agent.
21321266 2011 PET of ?vbeta3-integrin and ?vbeta5-integrin expression with 18F-fluciclatide for assessment of response to targeted therapy: ready for prime time?
21310825 2011 The androgen receptor induces integrin ?6?1 to promote prostate tumor cell survival via NF-?B and Bcl-xL Independently of PI3K signaling.
21283814 2011 Acidic extracellular pH promotes activation of integrin ?(v)?(3).
21269460 2011 Initial characterization of the human central proteome.
21182210 2010 Lack of association between markers in the ITGA3, ITGAV, ITGA6 and ITGB3 and autism in an Irish sample.
21178476 Integrins as triggers of Epstein-Barr virus fusion and epithelial cell infection.
21150164 2011 Downregulation of the integrin ?(v) signaling pathway in uterine leiomyomas.
21135163 2011 Sequential binding of ?V?3 and ICAM-1 determines fibrin-mediated melanoma capture and stable adhesion to CD11b/CD18 on neutrophils.
21116829 2011 A polymorphism in the integrin ?V subunit gene affects the progression of primary biliary cirrhosis in Japanese patients.
21098231 2011 ?5 integrin is the major contributor to the ?Vintegrin-mediated blockade of HIV-1 replication.
21037076 2010 The coagulation system contributes to alphaVbeta6 integrin expression and liver fibrosis induced by cholestasis.
20972812 2011 The cross-talk between the urokinase receptor and fMLP receptors regulates the activity of the CXCR4 chemokine receptor.
20945385 2011 Leptin increases motility and integrin up-regulation in human prostate cancer cells.
20942236 2010 [Expression and significance of integrins subunits in laryngeal squamous cell carcinoma].
20926544 2011 Allele polymorphisms of tumor integrins correlate with peritoneal carcinosis capability of gastric cancer cells in radically resected patients.
20857483 2011 TNF-? increases ?v?3 integrin expression and migration in human chondrosarcoma cells.
20838674 2010 Two-dimensional heteronuclear saturation transfer difference NMR reveals detailed integrin ?v?6 protein-peptide interactions.
20837477 2010 Entamoeba histolytica cysteine proteinase 5 binds integrin on colonic cells and stimulates NFkappaB-mediated pro-inflammatory responses.
20826760 2010 HMGB1 inhibits macrophage activity in efferocytosis through binding to the alphavbeta3-integrin.
20719960 2010 Integrin-mediated cell attachment induces a PAK4-dependent feedback loop regulating cell adhesion through modified integrin alpha v beta 5 clustering and turnover.
20715172 2011 Increased expression and serum levels of the stromal cell-secreted protein periostin in breast cancer bone metastases.
20682778 2010 Direct binding of the EGF-like domain of neuregulin-1 to integrins ({alpha}v{beta}3 and {alpha}6{beta}4) is involved in neuregulin-1/ErbB signaling.
20672329 2011 ?V?3 integrin regulates macrophage inflammatory responses via PI3 kinase/Akt-dependent NF-?B activation.
20639902 2010 Lung cancer cell migration is regulated via repressing growth factor PTN/RPTP ?/? signaling by menin.
20638909 2010 Osteopontin and alphavbeta3 integrin as markers of endometrial receptivity: the effect of different hormone therapies.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626753 2010 Significance of integrin ?v?5 and erbB3 in enhanced cell migration and liver metastasis of colon carcinomas stimulated by hepatocyte-derived heregulin.
20615244 2010 Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells.
20605574 2011 Difucosylated oligosaccharide Lewis Y is contained within integrin ?v?3 on RL95-2 cells and required for endometrial receptivity.
20600001 2010 Heparin binding domain in vitronectin is required for oligomerization and thus enhances integrin mediated cell adhesion and spreading.
20563599 2010 Integrin expression and integrin-mediated adhesion in vitro of human multipotent stromal cells (MSCs) to endothelial cells from various blood vessels.
20558745 2010 Secreted heat shock protein 90alpha induces colorectal cancer cell invasion through CD91/LRP-1 and NF-kappaB-mediated integrin alphaV expression.
20554778 2010 Interaction of alphaVbeta3 and alphaVbeta6 integrins with human parechovirus 1.
20519501 2010 Angiopoietin-2 stimulation of endothelial cells induces alphavbeta3 integrin internalization and degradation.
20477989 2010 Protein kinase D1 regulates VEGF-A-induced alphavbeta3 integrin trafficking and endothelial cell migration.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20400979 2010 Ovarian cancer ascites protects from TRAIL-induced cell death through alphavbeta5 integrin-mediated focal adhesion kinase and Akt activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20306691 2008 Leukocytic-vascular endothelial growth factor and integrin alphavbeta3 in acute myeloid leukemia: relation to clinical outcome.
20224109 2010 Correlation of the expression of integrin ?V?3 in endometrium and peripheral blood lymphocytes in infertile patients.
20158572 2011 Enhanced platelet adhesion induces angiogenesis in intestinal inflammation and inflammatory bowel disease microvasculature.
20121756 2010 Mast cell adhesion to bronchial smooth muscle in asthma specifically depends on CD51 and CD44 variant 6.
20037822 2009 Implication of expression of osteopontin and its receptor integrin alphanubeta3 in the placenta in the development of preeclampsia.
20033473 2010 Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.
20026907 Definitive endoderm derived from human embryonic stem cells highly express the integrin receptors alphaV and beta5.
20019187 2010 Reduced expression of integrin alphavbeta8 is associated with brain arteriovenous malformation pathogenesis.
19998373 2010 Identification of vitronectin as an extrinsic inducer of cancer stem cell differentiation and tumor formation.
19933311 2010 Characterization of integrin engagement during defined human embryonic stem cell culture.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910644 2010 Leptin enhances the potency of circulating angiogenic cells via src kinase and integrin (alpha)vbeta5: implications for angiogenesis in human obesity.
19889638 2010 Oscillatory flow-induced proliferation of osteoblast-like cells is mediated by alphavbeta3 and beta1 integrins through synergistic interactions of focal adhesion kinase and Shc with phosphatidylinositol 3-kinase and the Akt/mTOR/p70S6K pathway.
19888537 2009 Variable effects of alpha v suppression on VEGFR-2 expression in endothelial cells of different vascular beds.
19888429 2009 The roles of platelet GPIIb/IIIa and alphavbeta3 integrins during HeLa cells adhesion, migration, and invasion to monolayer endothelium under static and dynamic shear flow.
19882657 2010 Site-specific inhibition of integrin alpha v beta 3-vitronectin association by a ser-asp-val sequence through an Arg-Gly-Asp-binding site of the integrin.
19837659 2009 Alphav beta3 integrin limits the contribution of neuropilin-1 to vascular endothelial growth factor-induced angiogenesis.
19818132 2009 The ITGAV rs3738919 variant and susceptibility to rheumatoid arthritis in four Caucasian sample sets.
19815712 2009 Sphingosine kinase-1 associates with integrin {alpha}V{beta}3 to mediate endothelial cell survival.
19811096 2010 Roles of integrins in human induced pluripotent stem cell growth on Matrigel and vitronectin.
19808644 2009 {beta}3-integrin expression on tumor cells inhibits tumor progression, reduces metastasis, and is associated with a favorable prognosis in patients with ovarian cancer.
19808093 2010 Leberagin-C, A disintegrin-like/cysteine-rich protein from Macrovipera lebetina transmediterranea venom, inhibits alphavbeta3 integrin-mediated cell adhesion.
19751734 2010 Endogenous IGF-I and alphaVbeta3 integrin ligands regulate increased smooth muscle hyperplasia in stricturing Crohn's disease.
19710103 2010 Up-regulation of integrin expression in lung adenocarcinoma cells caused by bacterial infection: in vitro study.
19704023 2009 Crystal structure of the complete integrin alphaVbeta3 ectodomain plus an alpha/beta transmembrane fragment.
19695571 2010 Periostin mediates vascular smooth muscle cell migration through the integrins alphavbeta3 and alphavbeta5 and focal adhesion kinase (FAK) pathway.
19617625 2009 Cell adhesion to tropoelastin is mediated via the C-terminal GRKRK motif and integrin alphaVbeta3.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19581046 2010 Vascular endothelial growth factor (VEGF) enhances gastric carcinoma invasiveness via integrin alpha(v)beta6.
19578119 2009 The direct binding of insulin-like growth factor-1 (IGF-1) to integrin alphavbeta3 is involved in IGF-1 signaling.
19549907 2009 Targeted in vivo imaging of integrin alphavbeta6 with an improved radiotracer and its relevance in a pancreatic tumor model.
19541645 2009 Activation of tumor cell integrin alphavbeta3 controls angiogenesis and metastatic growth in the brain.
19487690 2009 Plasminogen activator inhibitor-1 regulates integrin alphavbeta3 expression and autocrine transforming growth factor beta signaling.
19475568 2009 Osteopontin increases migration and MMP-9 up-regulation via alphavbeta3 integrin, FAK, ERK, and NF-kappaB-dependent pathway in human chondrosarcoma cells.
19448673 2009 Upregulation of Eps8 in oral squamous cell carcinoma promotes cell migration and invasion through integrin-dependent Rac1 activation.
19435649 2009 Down-regulation of alphav integrin by retroviral delivery of small interfering RNA reduces multicellular resistance of HT29.
19371633 2009 Tumor suppressor KAI1 affects integrin alphavbeta3-mediated ovarian cancer cell adhesion, motility, and proliferation.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19334037 2009 Integrin alphavbeta3 upregulates integrin-linked kinase expression in human ovarian cancer cells via enhancement of ILK gene transcription.
19267182 2010 Cyclic DGR-peptidomimetic containing a bicyclic reverse turn inducer as a selective alpha(v)beta (5) integrin ligand.
19255147 2009 Syndecan-1 regulates alphavbeta3 and alphavbeta5 integrin activation during angiogenesis and is blocked by synstatin, a novel peptide inhibitor.
19212638 2009 Quantitative gene-expression of the tumor angiogenesis markers vascular endothelial growth factor, integrin alphaV and integrin beta3 in human neuroendocrine tumors.
19212436 2009 The integrin antagonist cilengitide activates alphaVbeta3, disrupts VE-cadherin localization at cell junctions and enhances permeability in endothelial cells.
19164533 2009 Integrin alphavbeta1 promotes infection by human metapneumovirus.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19141530 2009 Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.
19118218 2009 Integrin-linked kinase is required for vitronectin-mediated internalization of Streptococcus pneumoniae by host cells.
19088289 2009 Integrin alphaVbeta6 is a high-affinity receptor for coxsackievirus A9.
19074851 2008 alphavbeta3 Integrin-dependent antiangiogenic activity of resveratrol stereoisomers.
19061491 2008 Tumor necrosis is associated with increased alphavbeta3 integrin expression and poor prognosis in nodular cutaneous melanomas.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19037107 2009 Mannose 6-phosphate/insulin-like growth factor 2 receptor limits cell invasion by controlling alphaVbeta3 integrin expression and proteolytic processing of urokinase-type plasminogen activator receptor.
19017937 2008 Increased osteopontin expression in dendritic cells amplifies IL-17 production by CD4+ T cells in experimental autoimmune encephalomyelitis and in multiple sclerosis.
18927433 2009 Integrin alpha(v)beta(3) on human endothelial cells binds von Willebrand factor strings under fluid shear stress.
18854176 2008 Integrin alphavbeta3-mediated transcriptional regulation of TIMP-1 in a human ovarian cancer cell line.
18844213 2009 Inhibition of migration and invasion of carcinoma cells by urokinase-derived antagonists of alphavbeta5 integrin activation.
18821851 2009 Apolipoprotein(a) stimulates vascular endothelial cell growth and migration and signals through integrin alphaVbeta3.
18814143 2009 Stromal cell-derived factor-1 increase alphavbeta3 integrin expression and invasion in human chondrosarcoma cells.
18781095 2008 Vitronectin and its receptors partly mediate adhesion of ovarian cancer cells to peritoneal mesothelium in vitro.
18698261 2008 Overexpression of the alphavbeta6 integrin in endometrial cancer.
18695916 2008 Integrin alphavbeta3 is not significantly implicated in the anti-migratory effect of anti-angiogenic urokinase kringle domain.
18694400 2009 Integrin alpha V polymorphisms and haplotypes in a Korean population are associated with susceptibility to chronic hepatitis and hepatocellular carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18648521 2008 The CXC-chemokine CXCL4 interacts with integrins implicated in angiogenesis.
18635536 2008 Pro-inflammatory secretory phospholipase A2 type IIA binds to integrins alphavbeta3 and alpha4beta1 and induces proliferation of monocytic cells in an integrin-dependent manner.
18550570 2008 Polymorphisms in predicted microRNA-binding sites in integrin genes and breast cancer: ITGB4 as prognostic marker.
18549690 2008 Osteopontin and alphavbeta3 integrin expression in the endometrium of infertile and fertile women.
18451156 2008 alpha vbeta 6 Integrin promotes the invasion of morphoeic basal cell carcinoma through stromal modulation.
18445685 2008 PAI1 stimulates assembly of the fibronectin matrix in osteosarcoma cells through crosstalk between the alphavbeta5 and alpha5beta1 integrins.
18441324 2008 Direct binding of integrin alphavbeta3 to FGF1 plays a role in FGF1 signaling.
18427826 2009 Role of the alpha v-integrin subunit in cell proliferation, apoptosis and tumor metastasis of laryngeal and hypopharyngeal squamous cell carcinomas: a clinical and in vitro investigation.
18395422 2008 Endogenous Gas6 and Ca2+ -channel activation modulate phagocytosis by retinal pigment epithelium.
18394009 2008 Expression of integrin alphavbeta3 in gliomas correlates with tumor grade and is not restricted to tumor vasculature.
18364349 2008 Roles of Necl-5/poliovirus receptor and Rho-associated kinase (ROCK) in the regulation of transformation of integrin alpha(V)beta(3)-based focal complexes into focal adhesions.
18357713 2008 [Expression of alpha-v integrin subunit in the laryngeal and hypopharyngeal squamous cell carcinomas and its relationship with tumor angiogenesis].
18353785 2008 Transforming growth factor beta1 induces alphavbeta3 integrin expression in human lung fibroblasts via a beta3 integrin-, c-Src-, and p38 MAPK-dependent pathway.
18353318 2009 Infertile women with isolated polycystic ovaries are deficient in endometrial expression of osteopontin but not alphavbeta3 integrin during the implantation window.
18349127 2008 Induction of an epithelial integrin alphavbeta6 in human cytomegalovirus-infected endothelial cells leads to activation of transforming growth factor-beta1 and increased collagen production.
18345483 2008 Does histamine influence differentiation of trophoblast in preeclampsia?
18331351 2008 Interaction and functional association of protein disulfide isomerase with alphaVbeta3 integrin on endothelial cells.
18310446 2008 Thyroid hormone stimulation of extracellular signal-regulated kinase and cell proliferation in human osteoblast-like cells is initiated at integrin alphaVbeta3.
18310319 2008 Tumor cell cycle arrest induced by shear stress: Roles of integrins and Smad.
18247041 2008 Rho GTPases mediated integrin alpha v beta 3 activation in sphingosine-1-phosphate stimulated chemotaxis of endothelial cells.
18227168 2008 Streptococcal pyrogenic exotoxin B-induced apoptosis in A549 cells is mediated through alpha(v)beta(3) integrin and Fas.
18221819 2008 Integrin alphavbeta6 is a marker of the progression of biliary and portal liver fibrosis and a novel target for antifibrotic therapies.
18211678 2008 Suppression subtractive hybridization profiles of radial growth phase and metastatic melanoma cell lines reveal novel potential targets.
18191107 2008 TGF-beta1 increases motility and alphavbeta3 integrin up-regulation via PI3K, Akt and NF-kappaB-dependent pathway in human chondrosarcoma cells.
18090124 2007 The role of adhesion molecules, alpha v beta 3, alpha v beta 5 and their ligands in the tumor cell and endothelial cell adhesion.
18084301 2008 Modification of kidney barrier function by the urokinase receptor.
18079201 2008 Substrate-bound insulin-like growth factor (IGF)-I-IGF binding protein-vitronectin-stimulated breast cell migration is enhanced by coactivation of the phosphatidylinositide 3-Kinase/AKT pathway by alphav-integrins and the IGF-I receptor.
18064530 2008 CNTO 95, a fully human anti alphav integrin antibody, inhibits cell signaling, migration, invasion, and spontaneous metastasis of human breast cancer cells.
18062611 2007 Mechanotransduction in lymphatic endothelial cells.
18045938 2008 Integrin alphaVbeta3 Binds to the RGD motif of glycoprotein B of Kaposi's sarcoma-associated herpesvirus and functions as an RGD-dependent entry receptor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17965016 2008 Involvement of nectin in inactivation of integrin alpha(v)beta(3) after the establishment of cell-cell adhesion.
17925226 2007 Rab25 associates with alpha5beta1 integrin to promote invasive migration in 3D microenvironments.
17879163 2007 An altered fibronectin matrix induces anoikis of human squamous cell carcinoma cells by suppressing integrin alpha v levels and phosphorylation of FAK and ERK.
17854909 2008 Macrophage migration inhibitory factor up-regulates alpha(v)beta(3) integrin and vascular endothelial growth factor expression in endometrial adenocarcinoma cell line Ishikawa.
17641225 2007 Mechanisms of integrin-vascular endothelial growth factor receptor cross-activation in angiogenesis.
17621633 2007 Expression profiling reveals genes associated with transendothelial migration of tumor cells: a functional role for alphavbeta3 integrin.
17615072 2007 The ITGAV rs3738919-C allele is associated with rheumatoid arthritis in the European Caucasian population: a family-based study.
17550972 2007 CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway.
17483236 2007 Small-molecule cyclic alpha V beta 3 antagonists inhibit sickle red cell adhesion to vascular endothelium and vasoocclusion.
17446174 2007 Necl-5/poliovirus receptor interacts in cis with integrin alphaVbeta3 and regulates its clustering and focal complex formation.
17408468 2007 Genetic polymorphisms associated with priapism in sickle cell disease.
17369840 2007 Prostate cancer specific integrin alphavbeta3 modulates bone metastatic growth and tissue remodeling.
17331499 2007 Chemical modulation of VLA integrin affinity in human breast cancer cells.
17300927 2007 Lebectin and lebecetin, two C-type lectins from snake venom, inhibit alpha5beta1 and alphaV-containing integrins.
17275949 2007 Integrin alphavbeta6 mediates HT29-D4 cell adhesion to MMP-processed fibrinogen in the presence of Mn2+.
17175151 2007 The type I collagen induction of MT1-MMP-mediated MMP-2 activation is repressed by alphaVbeta3 integrin in human breast cancer cells.
17158881 2007 alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17034033 2007 Expression and activation of alpha v beta 3 integrins by SDF-1/CXC12 increases the aggressiveness of prostate cancer cells.
16982628 2006 Proteolytically processed soluble tumor endothelial marker (TEM) 5 mediates endothelial cell survival during angiogenesis by linking integrin alpha(v)beta3 to glycosaminoglycans.
16973584 2006 Specificity of the VP1 GH loop of Foot-and-Mouth Disease virus for alphav integrins.
16947382 2006 Up-regulated transforming growth factor beta-inducible gene h3 in rheumatoid arthritis mediates adhesion and migration of synoviocytes through alpha v beta3 integrin: Regulation by cytokines.
16877343 2006 Integrin-mediated transforming growth factor-beta activation regulates homeostasis of the pulmonary epithelial-mesenchymal trophic unit.
16835373 2006 Blockade of alpha v beta3 and alpha v beta5 integrins by RGD mimetics induces anoikis and not integrin-mediated death in human endothelial cells.
16818691 2006 Positron emission tomography using [18F]Galacto-RGD identifies the level of integrin alpha(v)beta3 expression in man.
16790523 2006 Integrin alphaVbeta3 contains a receptor site for resveratrol.
16731529 2006 Integrin alpha3beta1, a novel receptor for alpha3(IV) noncollagenous domain and a trans-dominant Inhibitor for integrin alphavbeta3.
16702213 2006 Transduction of a mesenchyme-specific gene periostin into 293T cells induces cell invasive activity through epithelial-mesenchymal transformation.
16675963 2006 Involvement of alphavbeta5 integrin in the establishment of autocrine TGF-beta signaling in dermal fibroblasts derived from localized scleroderma.
16672769 2006 betaig-h3 triggers signaling pathways mediating adhesion and migration of vascular smooth muscle cells through alphavbeta5 integrin.
16631833 2006 Expression of alpha V integrin is modulated by Epstein-Barr virus nuclear antigen 3C and the metastasis suppressor Nm23-H1 through interaction with the GATA-1 and Sp1 transcription factors.
16631740 2006 Alpha-V-dependent outside-in signaling is required for the regulation of CD44 surface expression, MMP-2 secretion, and cell migration by osteopontin in human melanoma cells.
16614246 2006 The apoptotic-cell receptor CR3, but not alphavbeta5, is a regulator of human dendritic-cell immunostimulatory function.
16496302 2006 Thymosin beta10 inhibits cell migration and capillary-like tube formation of human coronary artery endothelial cells.
16448724 2007 Alpha2beta1 and alphaVbeta1 integrin signaling pathways mediate amyloid-beta-induced neurotoxicity.
16407244 2006 Non-cytotoxic cobra cardiotoxin A5 binds to alpha(v)beta3 integrin and inhibits bone resorption. Identification of cardiotoxins as non-RGD integrin-binding proteins of the Ly-6 family.
16400188 2006 Insulin-like growth factor 1 is a potent stimulator of cervical cancer cell invasiveness and proliferation that is modulated by alphavbeta3 integrin signaling.
16385340 2006 Expression of integrins in cerebral arteriovenous and cavernous malformations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16186116 2005 The P2Y2 nucleotide receptor interacts with alphav integrins to activate Go and induce cell migration.
16150802 2005 Alphavbeta3-targeted detection of arteriopathy in transplanted human coronary arteries: an autoradiographic study.
16105876 2005 alpha(v)beta3-integrin-dependent activation of focal adhesion kinase mediates NF-kappaB activation and motogenic activity by HIV-1 Tat in endothelial cells.
16100012 2005 Gene expression changes during the development of acute lung injury: role of transforming growth factor beta.
16099422 2005 Murine lipid phosphate phosphohydrolase-3 acts as a cell-associated integrin ligand.
16024014 2005 Alpha v beta 6 integrin down-regulates the MMP-13 expression in oral squamous cell carcinoma cells.
16005200 2005 Distinct structural requirements for binding of the integrins alphavbeta6, alphavbeta3, alphavbeta5, alpha5beta1 and alpha9beta1 to osteopontin.
15998788 2005 alpha v beta3-dependent cross-presentation of matrix metalloproteinase-2 by melanoma cells gives rise to a new tumor antigen.
15925879 2005 Characterization of the integrin alpha v beta3 in arteriovenous malformations and cavernous malformations.
15921657 2005 Gal3ST-2 involved in tumor metastasis process by regulation of adhesion ability to selectins and expression of integrins.
15914035 2005 Adhesion of human ovarian adenocarcinoma IGROV1 cells to endothelial cells is partly mediated by the alphav integrins-vitronectin adhesive system and induces an alteration of endothelial integrity.
15897908 2005 Interaction of human Thy-1 (CD 90) with the integrin alphavbeta3 (CD51/CD61): an important mechanism mediating melanoma cell adhesion to activated endothelium.
15866865 2005 Cross-talk between fMLP and vitronectin receptors triggered by urokinase receptor-derived SRSRY peptide.
15834425 2005 Integrin alphavbeta3 is a coreceptor for human cytomegalovirus.
15828940 Hypoxia increases reepithelialization via an alphavbeta6-dependent pathway.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15795319 2005 Three-dimensional EM structure of the ectodomain of integrin {alpha}V{beta}3 in a complex with fibronectin.
15695828 2005 Tyrosine phosphorylation of beta3 integrin provides a binding site for Pyk2.
15647827 2005 Alphavbeta integrins play an essential role in BMP-2 induction of osteoblast differentiation.
15638730 2005 Non peptidic alphavbeta3 antagonists: recent developments.
15611078 2005 Integrin-dependent functions of the angiogenic inducer NOV (CCN3): implication in wound healing.
15609323 2005 Transmigration of human ovarian adenocarcinoma cells through endothelial extracellular matrix involves alphav integrins and the participation of MMP2.
15557124 2004 Integrin alphav-mediated inactivation of p53 controls a MEK1-dependent melanoma cell survival pathway in three-dimensional collagen.
15509546 2004 CEACAM1 enhances invasion and migration of melanocytic and melanoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361064 2005 The disintegrin domain of ADAM9: a ligand for multiple beta1 renal integrins.
15299032 2004 A novel adaptation of the integrin PSI domain revealed from its crystal structure.
15269586 2004 Alpha V integrin prolongs collagenase production through Jun activation binding protein 1.
15215180 2004 Regulation of macrophage foam cell formation by alphaVbeta3 integrin: potential role in human atherosclerosis.
15194773 2004 Integrin alpha v beta 6 is an RGD-dependent receptor for coxsackievirus A9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15051489 2004 Functional differences between integrin alpha4 and integrins alpha5/alphav in modulating the motility of human oral squamous carcinoma cells in response to the V region and heparin-binding domain of fibronectin.
15044441 2004 Engagement of alphavbeta3 integrin regulates proliferation and apoptosis of hepatic stellate cells.
14966135 2004 Cholesterol-independent interactions with CD47 enhance alphavbeta3 avidity.
14766759 2004 Alphav-integrin utilization in human beta-cell adhesion, spreading, and motility.
14741360 2004 The endoproteolytic processing of alphavbeta5 integrin is involved in cytoskeleton remodelling and cell migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14666169 2001 Endometrial receptivity: expression of alpha3beta1, alpha4beta1 and alphaVbeta1 endometrial integrins in women with impaired fertility.
14596610 2003 Mass spectrometric based mapping of the disulfide bonding patterns of integrin alpha chains.
14524530 2003 Inhibition of alpha(v)beta3 integrin reduces angiogenesis, bone turnover, and tumor cell proliferation in experimental prostate cancer bone metastases.
12917446 2003 Alphavbeta6-Fyn signaling promotes oral cancer progression.
12902636 Adhesion of endothelial cells to NOV is mediated by the integrins alphavbeta3 and alpha5beta1.
12893184 2003 AlphaV- and beta1-integrin subunits are commonly expressed in malignant effusions from ovarian carcinoma patients.
12875973 2003 Integrin alphavbeta8-mediated activation of transforming growth factor-beta inhibits human airway epithelial proliferation in intact bronchial tissue.
12874388 2003 Activated integrin alphavbeta3 cooperates with metalloproteinase MMP-9 in regulating migration of metastatic breast cancer cells.
12807887 2003 Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins.
12765524 2003 Role of integrin alphavbeta3 in substrate-dependent apoptosis of human intestinal carcinoma cells.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12750158 2003 Signaling through JAM-1 and alphavbeta3 is required for the angiogenic action of bFGF: dissociation of the JAM-1 and alphavbeta3 complex.
12695522 2003 CCN3 (NOV) is a novel angiogenic regulator of the CCN protein family.
12691260 2003 Integrin alphavbeta3 binding to human alpha5-laminins facilitates FGF-2- and VEGF-induced proliferation of human ECV304 carcinoma cells.
12682293 2003 Human tumstatin and human endostatin exhibit distinct antiangiogenic activities mediated by alpha v beta 3 and alpha 5 beta 1 integrins.
12660257 2003 The effect of different hormone therapies on integrin expression and pinopode formation in the human endometrium: a controlled study.
12645863 2003 Reduced expression of alphavbeta3 integrin in the endometrium of unexplained infertility patients with recurrent IVF-ET failures: improvement by danazol treatment.
12642872 2003 alpha(v) integrins regulate cell proliferation through integrin-linked kinase (ILK) in ovarian cancer cells.
12639965 2003 Thymidine phosphorylase and 2-deoxyribose stimulate human endothelial cell migration by specific activation of the integrins alpha 5 beta 1 and alpha V beta 3.
12553378 2002 Role of integrin alpha(v)beta3 in the early phase of liver metastasis: PET and IVM analyses.
12486108 2002 The fibronectin-binding integrins alpha5beta1 and alphavbeta3 differentially modulate RhoA-GTP loading, organization of cell matrix adhesions, and fibronectin fibrillogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427871 2002 ECM regulates MT1-MMP localization with beta1 or alphavbeta3 integrins at distinct cell compartments modulating its internalization and activity on human endothelial cells.
12399420 2002 The alphaVbeta3 integrin regulates insulin-like growth factor I (IGF-I) receptor phosphorylation by altering the rate of recruitment of the Src-homology 2-containing phosphotyrosine phosphatase-2 to the activated IGF-I receptor.
12384999 2002 Overexpression of integrin alphav promotes human osteosarcoma cell populated collagen lattice contraction and cell migration.
12372811 2002 On the mechanism of thrombin-induced angiogenesis: involvement of alphavbeta3-integrin.
12372469 2002 Alterations in expression of endometrial endothelial nitric oxide synthase and alpha(v)beta(3) integrin in women with endometriosis.
12370491 2002 Mechanosensitive induction of apoptosis in fibroblasts is regulated by thrombospondin-1 and integrin associated protein (CD47).
12364323 2002 Pro-angiogenic activities of CYR61 (CCN1) mediated through integrins alphavbeta3 and alpha6beta1 in human umbilical vein endothelial cells.
12358597 2003 The integrin alphavbeta3 is a receptor for the latency-associated peptides of transforming growth factors beta1 and beta3.
12356872 2002 P21-activated kinase 4 interacts with integrin alpha v beta 5 and regulates alpha v beta 5-mediated cell migration.
12324470 2002 Identification of functional segments within the beta2I-domain of integrin alphaMbeta2.
12324452 2002 Fas activation induces renal tubular epithelial cell beta 8 integrin expression and function in the absence of apoptosis.
12270930 2002 Identification of motifs in the fasciclin domains of the transforming growth factor-beta-induced matrix protein betaig-h3 that interact with the alphavbeta5 integrin.
12237321 2002 Prostaglandin E2 promotes integrin alpha Vbeta 3-dependent endothelial cell adhesion, rac-activation, and spreading through cAMP/PKA-dependent signaling.
12237112 2002 Phosphoinositide 3-kinase C2alpha is activated upon smooth muscle cell migration and regulated by alpha(v)beta(3) integrin engagement.
12210725 2002 ERK activation and alpha v beta 3 integrin signaling through Shc recruitment in response to mechanical stimulation in human osteoblasts.
12198771 2002 Involvement of tumor cell integrin alpha v beta 3 in hematogenous metastasis of human melanoma cells.
12196561 2002 Myelin proteolipid protein forms a complex with integrins and may participate in integrin receptor signaling in oligodendrocytes.
12193380 2002 Characterization of integrin expression in the mouse ovary.
12177807 2002 Integrin alpha(v)beta6-associated ERK2 mediates MMP-9 secretion in colon cancer cells.
12168086 Role of the orphan nuclear receptor ROR alpha in the control of the metastatic behavior of androgen-independent prostate cancer cells.
12161360 2002 Alpha(v)beta(3) integrin engagement enhances cell invasiveness in human multiple myeloma.
12143051 2002 Expression, regulation, and function of alpha V integrins in hepatocellular carcinoma: an in vivo and in vitro study.
12099514 2002 Acute cellular rejection following human heart transplantation is associated with increased expression of vitronectin receptor (integrin alphavbeta3).
12082152 2002 Localization and possible role of two different alpha v beta 3 integrin conformations in resting and resorbing osteoclasts.
12063036 Role of vitronectin receptor-type integrins and osteopontin in ischemia-induced retinal neovascularization.
12042322 2002 Ancient ubiquitous protein 1 binds to the conserved membrane-proximal sequence of the cytoplasmic tail of the integrin alpha subunits that plays a crucial role in the inside-out signaling of alpha IIbbeta 3.
12031826 2002 Factor XIII mediates adhesion of platelets to endothelial cells through alpha(v)beta(3) and glycoprotein IIb/IIIa integrins.
11997396 2002 The selective regulation of alpha Vbeta 1 integrin expression is based on the hierarchical formation of alpha V-containing heterodimers.
11988838 The role of alpha(v)beta(3) in prostate cancer progression.
11970960 2002 The integrin alpha(v)beta8 mediates epithelial homeostasis through MT1-MMP-dependent activation of TGF-beta1.
11959660 2002 Del1 mediates VSMC adhesion, migration, and proliferation through interaction with integrin alpha(v)beta(3).
11953315 2002 The oligodendrocyte precursor mitogen PDGF stimulates proliferation by activation of alpha(v)beta3 integrins.
11934894 2002 Unique ability of integrin alpha(v)beta 3 to support tumor cell arrest under dynamic flow conditions.
11928818 2002 Osteopontin modulates prostate carcinoma invasive capacity through RGD-dependent upregulation of plasminogen activators.
11927607 2002 Src-mediated coupling of focal adhesion kinase to integrin alpha(v)beta5 in vascular endothelial growth factor signaling.
11884718 2002 Crystal structure of the extracellular segment of integrin alpha Vbeta3 in complex with an Arg-Gly-Asp ligand.
11882657 2002 Functional classification of ADAMs based on a conserved motif for binding to integrin alpha 9beta 1: implications for sperm-egg binding and other cell interactions.
11877390 2002 ANGPTL3 stimulates endothelial cell adhesion and migration via integrin alpha vbeta 3 and induces blood vessel formation in vivo.
11866539 2002 Identification of endothelial cell genes expressed in an in vitro model of angiogenesis: induction of ESM-1, (beta)ig-h3, and NrCAM.
11858476 2002 The role of alpha(v)beta3 integrins in vascular healing.
11848444 2002 Acute hyperglycaemia induces changes in the transcription levels of 4 major genes in human endothelial cells: macroarrays-based expression analysis.
11821050 2002 The integrin alphaVbeta6 binds and activates latent TGFbeta3.
11741954 2002 An alternative processing of integrin alpha(v) subunit in tumor cells by membrane type-1 matrix metalloproteinase.
11706074 2001 Integrin alpha(v)beta(3) expression in colon carcinoma correlates with survival.
11683411 2001 Podosomes in osteoclast-like cells: structural analysis and cooperative roles of paxillin, proline-rich tyrosine kinase 2 (Pyk2) and integrin alphaVbeta3.
11577104 2001 Phosphatidylinositol 3,4,5-trisphosphate directs association of Src homology 2-containing signaling proteins with gelsolin.
11546839 2001 Crystal structure of the extracellular segment of integrin alpha Vbeta3.
11435317 2001 Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms.
11331301 2001 An RGD sequence in the P2Y(2) receptor interacts with alpha(V)beta(3) integrins and is required for G(o)-mediated signal transduction.
11287419 2001 CYR61 stimulates human skin fibroblast migration through Integrin alpha vbeta 5 and enhances mitogenesis through integrin alpha vbeta 3, independent of its carboxyl-terminal domain.
11278329 2001 Tumor cell invasion is promoted by activation of protease activated receptor-1 in cooperation with the alpha vbeta 5 integrin.
11162558 2001 MDC-9 (ADAM-9/Meltrin gamma) functions as an adhesion molecule by binding the alpha(v)beta(5) integrin.
11160695 2001 Entry of human parechovirus 1.
11134507 2001 Disruption of matrix metalloproteinase 2 binding to integrin alpha vbeta 3 by an organic molecule inhibits angiogenesis and tumor growth in vivo.
10982404 2000 PECAM-1/CD31 trans-homophilic binding at the intercellular junctions is independent of its cytoplasmic domain; evidence for heterophilic interaction with integrin alphavbeta3 in Cis.
10965141 2000 Cloning and characterisation of ITGAV, the genomic sequence for human cell adhesion protein (vitronectin) receptor alpha subunit, CD51.
10871287 2000 Plasmin-sensitive dibasic sequences in the third fibronectin-like domain of L1-cell adhesion molecule (CAM) facilitate homomultimerization and concomitant integrin recruitment.
10837460 2000 Two RGD-independent alpha vbeta 3 integrin binding sites on tumstatin regulate distinct anti-tumor properties.
10835423 2000 Substrate specificity of alpha(v)beta(3) integrin-mediated cell migration and phosphatidylinositol 3-kinase/AKT pathway activation.
10821835 2000 Adhesion of human skin fibroblasts to Cyr61 is mediated through integrin alpha 6beta 1 and cell surface heparan sulfate proteoglycans.
10749942 2000 ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alphavbeta3 integrin through an RGD-independent mechanism.
10715259 2000 Angiotensin II has multiple profibrotic effects in human cardiac fibroblasts.
10708943 2000 An antisense oligonucleotide targeting the alphaV integrin gene inhibits adhesion and induces apoptosis in breast cancer cells.
10640428 2000 Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.
10570297 1999 Subversion of monocyte functions by coxiella burnetii: impairment of the cross-talk between alphavbeta3 integrin and CR3.
10549293 1999 Ubiquitin-related proteins regulate interaction of vimentin intermediate filaments with the plasma membrane.
10545994 1999 CD47 ligation induces caspase-independent cell death in chronic lymphocytic leukemia.
10537314 1999 Urokinase receptor interacts with alpha(v)beta5 vitronectin receptor, promoting urokinase-dependent cell migration in breast cancer.
10438928 1999 Inflammatory cytokines synergize with the HIV-1 Tat protein to promote angiogenesis and Kaposi's sarcoma via induction of basic fibroblast growth factor and the alpha v beta 3 integrin.
10397733 1999 The Tat protein of human immunodeficiency virus type-1 promotes vascular cell growth and locomotion by engaging the alpha5beta1 and alphavbeta3 integrins and by mobilizing sequestered basic fibroblast growth factor.
10218736 1999 Alphavbeta3 integrin binding affinity and specificity of SM256 in various species.
10037797 1999 The vitronectin receptor and its associated CD47 molecule mediates proinflammatory cytokine synthesis in human monocytes by interaction with soluble CD23.
9916748 1999 IFN-gamma induces endothelial cells to proliferate and to invade the extracellular matrix in response to the HIV-1 Tat protein: implications for AIDS-Kaposi's sarcoma pathogenesis.
9813179 1998 Regulation of Zn-alpha2-glycoprotein-mediated cell adhesion by kininogens and their derivatives.
9789327 1998 Integrins take partners: cross-talk between integrins and other membrane receptors.
9686320 1998 Adhesion of cultured human kidney mesangial cells to native entactin: role of integrin receptors.
9626063 1998 Fibronectin modulates the effects of HIV-1 Tat on the growth of murine Kaposi's sarcoma-like cells through the down-regulation of tyrosine phosphorylation.
9517988 1998 Monocyte-derived dendritic cells and monocytes migrate to HIV-Tat RGD and basic peptides.
9443892 1998 The alphavbeta5 integrin functions as an endocytic receptor for vitronectin.
9426447 1997 Integrin alpha v beta 6 enhances coxsackievirus B1 lytic infection of human colon cancer cells.
9256940 1997 The RGD-containing domain of exogenous HIV-1 Tat inhibits the engulfment of apoptotic bodies by dendritic cells.
9251239 1997 The alpha v beta 3 integrin "vitronectin receptor".
9133434 1997 Myoblast alpha v beta3 integrin levels are controlled by transcriptional regulation of expression of the beta3 subunit and down-regulation of beta3 subunit expression is required for skeletal muscle cell differentiation.
9108459 1997 Clinical significance of alpha(v)beta3 integrin and intercellular adhesion molecule-1 expression in cutaneous malignant melanoma lesions.
8798654 1996 Differential effects of the integrins alpha9beta1, alphavbeta3, and alphavbeta6 on cell proliferative responses to tenascin. Roles of the beta subunit extracellular and cytoplasmic domains.
8757349 1996 Pleiotropic effects of immobilized versus soluble recombinant HIV-1 Tat protein on CD3-mediated activation, induction of apoptosis, and HIV-1 long terminal repeat transactivation in purified CD4+ T lymphocytes.
8599839 1996 Human immunodeficiency virus type 1 tat protein modulates fibronectin expression in thymic epithelial cells and impairs in vitro thymocyte development.
8294396 1994 Rh-related antigen CD47 is the signal-transducer integrin-associated protein.
8034133 1994 The integrin subunits alpha 2, alpha 3, alpha 4, alpha 5, alpha 6, alpha V, beta 1 and beta 3 in fetal, infant and adult human spleen as detected by immunohistochemistry.
7690138 1993 The Tat protein of human immunodeficiency virus type 1, a growth factor for AIDS Kaposi sarcoma and cytokine-activated vascular cells, induces adhesion of the same cell types by using integrin receptors recognizing the RGD amino acid sequence.
7689573 1993 A study of the structure, function and distribution of beta 5 integrins using novel anti-beta 5 monoclonal antibodies.
7682219 1993 A novel integrin specificity exemplified by binding of the alpha v beta 5 integrin to the basic domain of the HIV Tat protein and vitronectin.
7678549 1993 Regional localization of the human vitronectin receptor alpha subunit gene (VNRA) to chromosome 2q31-->q32.
7545239 1995 Expression of alpha v beta 5 integrin is necessary for efficient adenovirus-mediated gene transfer in the human airway.
7539135 1995 Angiogenic properties of human immunodeficiency virus type 1 Tat protein.
7525578 1994 Integrin alpha v beta 8. Interaction with vitronectin and functional divergence of the beta 8 cytoplasmic domain.
7522056 1994 The integrin alpha v gene: identification and characterization of the promoter region.
7519807 1994 Entry of coxsackievirus A9 into host cells: specific interactions with alpha v beta 3 integrin, the vitronectin receptor.
7505120 1993 Solid-phase von Willebrand factor contains a conformationally active RGD motif that mediates endothelial cell adhesion through the alpha v beta 3 receptor.
2478219 1989 An integrin receptor on normal and thrombasthenic platelets that binds thrombospondin.
2467745 1989 A novel vitronectin receptor integrin (alpha v beta x) is responsible for distinct adhesive properties of carcinoma cells.
2454952 1988 Chromosomal localization of the genes for the vitronectin and fibronectin receptors alpha subunits and for platelet glycoproteins IIb and IIIa.
2450560 1987 Comparison of cDNA-derived protein sequences of the human fibronectin and vitronectin receptor alpha-subunits and platelet glycoprotein IIb.
2443500 1987 Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs.
2430295 1986 cDNA and amino acid sequences of the cell adhesion protein receptor recognizing vitronectin reveal a transmembrane domain and homologies with other adhesion protein receptors.
2202737 1990 Identification of an Arg-Gly-Asp (RGD) cell adhesion site in human immunodeficiency virus type 1 transactivation protein, tat.
2138612 1990 A novel fibronectin receptor with an unexpected subunit composition (alpha v beta 1).
1918072 1991 Cloning and expression of a divergent integrin subunit beta 8.
1694173 1990 Purification and functional characterization of integrin alpha v beta 5. An adhesion receptor for vitronectin.
1690718 1990 The integrin beta 1 subunit associates with the vitronectin receptor alpha v subunit to form a novel vitronectin receptor in a human embryonic kidney cell line.
1532572 1992 Characterization of the integrin alpha v beta 6 as a fibronectin-binding protein.