Property Summary

NCBI Gene PubMed Count 102
Grant Count 463
R01 Count 300
Funding $41,950,158.26
PubMed Score 172.97
PubTator Score 456.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P06753 D3DV71 P12324 Q2QD06 Q5VU58 Q5VU63 Q5VU66 Q5VU71 Q5VU72 Q8TCG3 Q969Q2 Q9NQH8
Symbols TM3
TM5
TRK
CFTD
NEM1
TM-5
TM30
CAPM1
TM30nm
TPMsk3
hscp30
HEL-189
HEL-S-82p
OK/SW-cl.5

Gene

Gene RIF (35)

PMID Text
26418456 This work expands the phenotypic spectrum of TPM3-related disease and provides insights into the pathophysiological mechanisms of the actin-tropomyosin complex
26307083 Dominant mutations in TPM3, encoding alpha-tropomyosinslow, cause a congenital myopathy characterized by generalized muscle weakness. Here, we used a multidisciplinary approach to investigate the mechanism of muscle dysfunction in 12 TPM3-myopathy patients.
25596129 Western blot showed phosphorylation of ALK, ERK1/2, and STAT3 in cells transfected with TPM3-ALK. Coiled-coil structure of TPM3 contributes to the transforming ability of the TPM3-ALK fusion protein, and longer TPM3 region leads to higher dimer formation.
24913705 DATA show that tropomyosin 3 protein (TPM3) plays a critical role in the progression of gliomas.
24692096 Patients with TPM2 mutations tended to present with milder symptoms than those with TPM3 mutations, DA being present only in the TPM2 group.
24507666 in a cohort of 94 patients with congenital myopathy, 2 related female patients and 2 sporadic male patients were found to carry mutations in TPM2 and TPM3 genes respectively; clinical presentation and muscle morphological findings differed in the patients
24239060 study reports on a three-generation family with cap myopathy caused by a novel heterozygous mutation in TPM3
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
22798622 TPM3-R167H mutations decreased cooperative thin filament activation in combination with reductions in the myosin cross-bridge number and force production.
22792281 TPM3 is an interacting partner of granulin-epithelin precursor and may play an important role in hepatocarcinogenesis.
More...

AA Sequence

MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKYSEALKDAQE      1 - 70
KLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEE     71 - 140
KMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEA    141 - 210
QAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALN    211 - 280
DMTSI                                                                     281 - 285
//

Text Mined References (109)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26418456 2015 TPM3 deletions cause a hypercontractile congenital muscle stiffness phenotype.
26307083 2015 Muscle weakness in TPM3-myopathy is due to reduced Ca2+-sensitivity and impaired acto-myosin cross-bridge cycling in slow fibres.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25596129 2015 Oncogenic TPM3-ALK activation requires dimerization through the coiled-coil structure of TPM3.
25416956 2014 A proteome-scale map of the human interactome network.
25369766 2015 A systematic nomenclature for mammalian tropomyosin isoforms.
24913705 2014 TPM3, a strong prognosis predictor, is involved in malignant progression through MMP family members and EMT-like activators in gliomas.
24692096 2014 Mutation update and genotype-phenotype correlations of novel and previously described mutations in TPM2 and TPM3 causing congenital myopathies.
More...