Tbio | Nucleophosmin |
Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. Antagonizes the inhibitory effect of ATF5 on cell proliferation and relieves ATF5-induced G2/M blockade (PubMed:22528486).
This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Nov 2009]
This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Nov 2009]
Comments
Disease | Target Count |
---|---|
Leukemia, Myelocytic, Acute | 113 |
Lymphoma, Primary Cutaneous Anaplastic Large Cell | 2 |
Stomach Neoplasms | 282 |
Disease | Target Count |
---|---|
Acute Promyelocytic Leukemia | 32 |
Leukemia, Acute Myeloid | 17 |
Lymphomatoid Papulosis | 2 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.287 | 0.006 |
Multiple myeloma | 1.809 | 0.003 |
oligodendroglioma | -1.100 | 0.010 |
psoriasis | 1.300 | 0.000 |
posterior fossa group A ependymoma | 1.200 | 0.000 |
glioblastoma | 1.700 | 0.007 |
sonic hedgehog group medulloblastoma | 2.300 | 0.000 |
atypical teratoid / rhabdoid tumor | 2.100 | 0.000 |
medulloblastoma, large-cell | 2.900 | 0.000 |
primitive neuroectodermal tumor | 1.100 | 0.000 |
acute quadriplegic myopathy | 1.044 | 0.000 |
primary pancreatic ductal adenocarcinoma | -1.538 | 0.007 |
non-small cell lung cancer | 1.017 | 0.000 |
lung cancer | 1.400 | 0.002 |
colon cancer | 1.800 | 0.012 |
diabetes mellitus | 2.300 | 0.001 |
lung adenocarcinoma | 1.100 | 0.000 |
pediatric high grade glioma | 1.400 | 0.000 |
subependymal giant cell astrocytoma | 1.289 | 0.044 |
mucosa-associated lymphoid tissue lympho... | -1.096 | 0.032 |
acute myeloid leukemia | 1.200 | 0.035 |
pancreatic cancer | -1.600 | 0.004 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG |
Platypus | OMA EggNOG |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26894557 | The NPM1 gene did not reveal any copy number alterations in acute myeloid leukemia. |
26847745 | Results show FLT3, NPM1, and CEBPA combination genotype confer favourable prognosis in AML |
26789727 | The presence of minimal residual disease, as determined by quantitation of NPM1-mutated transcripts, provided powerful prognostic information in AML independent of other risk factors. |
26666953 | NPM1 Mutation Detection in Acute Myeloid Leukemia |
26642792 | The results indicated significant differences in the integral optical density and less so in the areas of NPM+ nucleoli in leiomyosarcomas, but not in intact myometrium and leiomyomas. |
26559910 | NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape |
26536659 | demonstrated that p-NPM-Thr234/237 is critical in invasion and migration of hepatocellular carcinoma cells |
26343305 | Western blot and immunohistochemistry analysis showed that B23 was overexpressed in glioma tissues and glioma cell lines. |
26231209 | C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T |
26205693 | This finding implicates a new role of NPM1 in conveying tumorigenic signals from the BCR-ABL oncoprotein to ribosome biogenesis, affecting cellular growth. |
More... |
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS 1 - 70 PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG 71 - 140 KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN 141 - 210 GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD 211 - 280 QEAIQDLWQWRKSL 281 - 294 //
PMID | Year | Title |
---|---|---|
26894557 | 2016 | Simultaneous detection of mutations and copy number variation of NPM1 in the acute myeloid leukemia using multiplex ligation-dependent probe amplification. |
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26847745 | 2016 | The value of molecular stratification for CEBPA(DM) and NPM1(MUT) FLT3(WT) genotypes in older patients with acute myeloid leukaemia. |
26789727 | 2016 | Assessment of Minimal Residual Disease in Standard-Risk AML. |
26666953 | 2016 | NPM1 Mutation Detection in Acute Myeloid Leukemia: A Method Comparison Study. |
26642792 | 2015 | Expression of B23/Nucleophosphamine Nonribosomal Nucleolar Protein in Smooth Muscle Tumors of the Corpus Uteri. |
26559910 | 2015 | NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape. |
26536659 | 2015 | Phosphorylation of nucleophosmin at threonine 234/237 is associated with HCC metastasis. |
26343305 | 2015 | Upregulation of B23 promotes tumor cell proliferation and predicts poor prognosis in glioma. |
26231209 | 2015 | C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins. |
More... |