Property Summary

NCBI Gene PubMed Count 579
PubMed Score 1315.83
PubTator Score 988.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia 1.200 3.5e-02
acute quadriplegic myopathy 1.044 1.6e-04
adult high grade glioma 1.300 9.0e-06
atypical teratoid / rhabdoid tumor 2.100 4.1e-09
colon cancer 1.800 1.2e-02
diabetes mellitus 1.400 4.2e-03
ependymoma 1.100 2.4e-10
glioblastoma 1.300 7.5e-09
group 3 medulloblastoma 1.400 7.9e-05
lung adenocarcinoma 1.100 5.9e-14
lung cancer 1.400 2.1e-03
medulloblastoma, large-cell 2.900 1.8e-06
mucosa-associated lymphoid tissue lympho... -1.012 2.1e-02
Multiple myeloma 1.809 2.6e-03
non-small cell lung cancer 1.017 8.8e-15
oligodendroglioma -1.100 1.0e-02
pancreatic cancer -1.600 4.0e-03
primary pancreatic ductal adenocarcinoma -1.538 6.7e-03
primitive neuroectodermal tumor 1.100 2.7e-04
psoriasis 1.300 4.6e-04
subependymal giant cell astrocytoma 1.289 4.4e-02
Waldenstrons macroglobulinemia 1.287 6.1e-03

Gene RIF (532)

AA Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS      1 - 70
PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG     71 - 140
KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN    141 - 210
GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD    211 - 280
QEAIQDLWQWRKSL                                                            281 - 294
//

Text Mined References (614)

PMID Year Title