Property Summary

NCBI Gene PubMed Count 542
PubMed Score 1232.69
PubTator Score 988.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 8.83348954340295E-15
lung adenocarcinoma 2714 5.89860025835167E-14
posterior fossa group A ependymoma 1511 1.30451997621834E-10
atypical teratoid / rhabdoid tumor 4369 4.07620655304874E-9
sonic hedgehog group medulloblastoma 1482 3.29890594502459E-8
medulloblastoma, large-cell 6234 1.78433786410391E-6
pediatric high grade glioma 2712 5.99306343764732E-6
acute quadriplegic myopathy 1157 1.57700904498317E-4
primitive neuroectodermal tumor 3031 2.6959150573474E-4
psoriasis 6685 4.57110637562911E-4
diabetes mellitus 1663 0.00105862314600335
lung cancer 4473 0.00214938211748657
Multiple myeloma 1328 0.00255529538705322
pancreatic cancer 2300 0.00397991866869843
Waldenstrons macroglobulinemia 765 0.00611483020684938
primary pancreatic ductal adenocarcinoma 1271 0.00670946241825967
glioblastoma 5572 0.00719832512030638
oligodendroglioma 2849 0.0102266968884331
colon cancer 1475 0.012021880367618
mucosa-associated lymphoid tissue lymphoma 480 0.0320644260472841
acute myeloid leukemia 785 0.0347605202904486
subependymal giant cell astrocytoma 2287 0.0440435590636054
Disease Target Count Z-score Confidence
Cancer 2346 5.994 3.0

Expression

Gene

PANTHER Protein Class (1)

PDB

2LLH   2P1B   2VXD  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (496)

PMID Text
26894557 The NPM1 gene did not reveal any copy number alterations in acute myeloid leukemia.
26847745 Results show FLT3, NPM1, and CEBPA combination genotype confer favourable prognosis in AML
26789727 The presence of minimal residual disease, as determined by quantitation of NPM1-mutated transcripts, provided powerful prognostic information in AML independent of other risk factors.
26666953 NPM1 Mutation Detection in Acute Myeloid Leukemia
26642792 The results indicated significant differences in the integral optical density and less so in the areas of NPM+ nucleoli in leiomyosarcomas, but not in intact myometrium and leiomyomas.
26559910 NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape
26536659 demonstrated that p-NPM-Thr234/237 is critical in invasion and migration of hepatocellular carcinoma cells
26343305 Western blot and immunohistochemistry analysis showed that B23 was overexpressed in glioma tissues and glioma cell lines.
26231209 C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T
26205693 This finding implicates a new role of NPM1 in conveying tumorigenic signals from the BCR-ABL oncoprotein to ribosome biogenesis, affecting cellular growth.
More...

AA Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS      1 - 70
PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG     71 - 140
KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN    141 - 210
GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD    211 - 280
QEAIQDLWQWRKSL                                                            281 - 294
//

Text Mined References (573)

PMID Year Title
26894557 2016 Simultaneous detection of mutations and copy number variation of NPM1 in the acute myeloid leukemia using multiplex ligation-dependent probe amplification.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26847745 2016 The value of molecular stratification for CEBPA(DM) and NPM1(MUT) FLT3(WT) genotypes in older patients with acute myeloid leukaemia.
26789727 2016 Assessment of Minimal Residual Disease in Standard-Risk AML.
26666953 2016 NPM1 Mutation Detection in Acute Myeloid Leukemia: A Method Comparison Study.
26642792 2015 Expression of B23/Nucleophosphamine Nonribosomal Nucleolar Protein in Smooth Muscle Tumors of the Corpus Uteri.
26559910 2015 NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape.
26536659 2015 Phosphorylation of nucleophosmin at threonine 234/237 is associated with HCC metastasis.
26343305 2015 Upregulation of B23 promotes tumor cell proliferation and predicts poor prognosis in glioma.
26231209 2015 C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins.
More...