Property Summary

NCBI Gene PubMed Count 167
Grant Count 305
R01 Count 135
Funding $88,412,316.96
PubMed Score 396.78
PubTator Score 804.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer -1.100 0.005
hepatocellular carcinoma -1.800 0.000
pancreatic cancer -1.400 0.002
psoriasis 1.200 0.000
glioblastoma -1.100 0.007
diabetes mellitus -1.200 0.005
pancreatic carcinoma -1.400 0.002
subependymal giant cell astrocytoma -1.597 0.015
invasive ductal carcinoma 1.200 0.036
ovarian cancer 1.500 0.002

Synonym

Accession P06746 B2RC78 Q3KP48 Q6FI34
Symbols

Gene

PDB

1BPX   1BPY   1BPZ   1MQ2   1MQ3   1TV9   1TVA   1ZJM   1ZJN   1ZQA   1ZQB   1ZQC   1ZQD   1ZQE   1ZQF   1ZQG   1ZQH   1ZQI   1ZQJ   1ZQK   1ZQL   1ZQM   1ZQN   1ZQO   1ZQP   1ZQQ   1ZQR   1ZQS   1ZQT   2FMP   2FMQ   2FMS   2I9G   2ISO   2ISP   2P66   2PXI   3C2K   3C2L   3C2M   3GDX   3ISB   3ISC   3ISD   3JPN   3JPO   3JPP   3JPQ   3JPR   3JPS   3JPT   3LK9   3MBY   3OGU   3RH4   3RH5   3RH6   3RJE   3RJF   3RJG   3RJH   3RJI   3RJJ   3RJK   3TFR   3TFS   4DO9   4DOA   4DOB   4DOC   4F5N   4F5O   4F5P   4F5Q   4F5R   4GXI   4GXJ   4GXK   4JWM   4JWN   4KLD   4KLE   4KLF   4KLG   4KLH   4KLI   4KLJ   4KLL   4KLM   4KLO   4KLQ   4KLS   4KLT   4KLU   4LVS   4M2Y   4M47   4M9G   4M9H   4M9J   4M9L   4M9N   4MF2   4MF8   4MFA   4MFC   4MFF   4NLK   4NLN   4NLZ   4NM1   4NM2   4NXZ   4NY8   4O5C   4O5E   4O5K   4O9M   4P2H   4PGQ   4PGX   4PGY   4PH5   4PHA   4PHD   4PHE   4PHP   4PPX   4R63   4R64   4R65   4R66   4RPX   4RPY   4RPZ   4RQ0   4RQ1   4RQ2   4RQ3   4RQ4   4RQ5   4RQ6   4RQ7   4RQ8   4RT2   4RT3   4TUP   4TUQ   4TUR   4TUS   4UAW   4UAY   4UAZ   4UB1   4UB2   4UB3   4UB4   4UB5   4UBB   4UBC   4YMM   4YMN   4YMO   4YN4   4Z6C   4Z6D   4Z6E   4Z6F   5BOL   5BOM   5BPC   5DB6   5DB7   5DB8   5DB9   5DBA   5DBB   5DBC   7ICE   7ICF   7ICG   7ICH   7ICI   7ICJ   7ICK   7ICL   7ICM   7ICN   7ICO   7ICP   7ICQ   7ICR   7ICS   7ICT   7ICU   7ICV   8ICA   8ICB   8ICC   8ICE   8ICF   8ICG   8ICH   8ICI   8ICJ   8ICK   8ICL   8ICM   8ICN   8ICO   8ICP   8ICQ   8ICR   8ICS   8ICT   8ICU   8ICV   8ICW   8ICX   8ICY   8ICZ   9ICA   9ICB   9ICC   9ICE   9ICF   9ICG   9ICH   9ICI   9ICJ   9ICK   9ICL   9ICM   9ICN   9ICO   9ICP   9ICQ   9ICR   9ICS   9ICT   9ICU   9ICV   9ICW   9ICX   9ICY  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
485311 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of DNA Polymerase Beta
485314 confirmatory 4522 / 17590 / 315791 qHTS Assay for Inhibitors of DNA Polymerase Beta
540280 confirmatory 220 / 34 / 0 Inhibitors of DNA Polymerase Beta: Hit validation
540300 confirmatory 0 / 2 / 252 Inhibitors of DNA Polymerase Beta: Hit Validation in Klenow Fragment Assay
540301 confirmatory 0 / 21 / 233 Inhibitors of DNA Polymerase Beta: Hit Validation in HIV-RT Assay
540325 other 100 / 0 / 10 Inhibitors of DNA Polymerase Beta: Hit Validation in Radiolabeled Extension Assay

Gene RIF (135)

PMID Text
26917111 Pol lambda can incorporate rNMPs opposite normal bases or 8-oxo-G, and with a different fidelity. Further, the incorporation of rNMPs opposite 8-oxo-G delays repair by DNA glycosylases.
26527528 Data show that esophageal carcinoma (EC) cells expressing the DNA polymerase beta K167I variant to be sensitive to DNA damaging agents.
26238022 Since APE1, XRCC1 and POLB proteins operate downstream the same DNA repair pathway to eliminate DNA oxidative damage, their expression above basal levels found in our study could reveal excessive oxidative stress in high-grade bladder tumors.
26167925 findings indicate that the IKBKB and POLB SNPs confer no genetic predisposition to SLE risk in this Chinese Han population
26159783 POLB was pinpointed as a target gene of miR- 499. Additionally, we identified that miR-499 can enhance cisplatin's function of inhibiting proliferation and of promoting apoptosis in EC9706 and KYSE30 cell lines.
25879709 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25687118 Fen1 significantly stimulated trinucleotide repeats expansion by Pol beta, but not by the related enzyme Pol lambda.
25561897 The results suggest that POLB gene with T889C mutation in surgically resected primary gastric tissues may be clinically useful for predicting responsiveness to chemotherapy in patients with GC.
25460917 DNA polymerase beta catalyzes lesion bypass across benzo[a]pyrene-derived DNA adduct in an error prone manner.
25423885 HSP90 regulates DNA repair by interaction between XRCC1 and DNA polymerase beta.
More...

AA Sequence

MSKRKAPQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIA      1 - 70
EKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGL     71 - 140
KYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESTKQPKL    141 - 210
LHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNK    211 - 280
NMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE                   281 - 335
//

Text Mined References (170)

PMID Year Title
26917111 2016 Impact of ribonucleotide incorporation by DNA polymerases ? and ? on oxidative base excision repair.
26527528 2015 The K167I variant of DNA polymerase ? that is found in Esophageal Carcinoma patients impairs polymerase activity and BER.
26238022 2015 Impact of reduced levels of APE1 transcripts on the survival of patients with urothelial carcinoma of the bladder.
26167925 2015 Genetic Variants of I?B Kinase ? (IKBKB) and Polymerase ? (POLB) Were Not Associated with Systemic Lupus Erythematosus Risk in a Chinese Han Population.
26159783 2015 MiR-499 Enhances the Cisplatin Sensitivity of Esophageal Carcinoma Cell Lines by Targeting DNA Polymerase ?.
25879709 2015 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25687118 2015 Expansion of CAG triplet repeats by human DNA polymerases ? and ? in vitro, is regulated by flap endonuclease 1 and DNA ligase 1.
25561897 2015 Clinical significance of a point mutation in DNA polymerase beta (POLB) gene in gastric cancer.
25460917 2014 Human DNA polymerases catalyze lesion bypass across benzo[a]pyrene-derived DNA adduct clustered with an abasic site.
25423885 2014 HSP90 regulates DNA repair via the interaction between XRCC1 and DNA polymerase ?.
More...