Property Summary

Ligand Count 6
NCBI Gene PubMed Count 187
PubMed Score 415.20
PubTator Score 804.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
diabetes mellitus -1.200 5.0e-03
gastric cancer -1.100 4.7e-03
glioblastoma -1.100 7.1e-03
hepatocellular carcinoma -1.800 7.0e-06
invasive ductal carcinoma 1.200 3.6e-02
ovarian cancer 1.500 1.6e-03
pancreatic cancer -1.400 2.4e-03
pancreatic carcinoma -1.400 2.4e-03
psoriasis 1.100 8.3e-03
subependymal giant cell astrocytoma -1.597 1.5e-02

Synonym

Accession P06746 B2RC78 Q3KP48 Q6FI34
Symbols

Gene

PDB

1BPX   1BPY   1BPZ   1MQ2   1MQ3   1TV9   1TVA   1ZJM   1ZJN   1ZQA   1ZQB   1ZQC   1ZQD   1ZQE   1ZQF   1ZQG   1ZQH   1ZQI   1ZQJ   1ZQK   1ZQL   1ZQM   1ZQN   1ZQO   1ZQP   1ZQQ   1ZQR   1ZQS   1ZQT   2FMP   2FMQ   2FMS   2I9G   2ISO   2ISP   2P66   2PXI   3C2K   3C2L   3C2M   3GDX   3ISB   3ISC   3ISD   3JPN   3JPO   3JPP   3JPQ   3JPR   3JPS   3JPT   3LK9   3MBY   3OGU   3RH4   3RH5   3RH6   3RJE   3RJF   3RJG   3RJH   3RJI   3RJJ   3RJK   3TFR   3TFS   4DO9   4DOA   4DOB   4DOC   4F5N   4F5O   4F5P   4F5Q   4F5R   4GXI   4GXJ   4GXK   4JWM   4JWN   4KLD   4KLE   4KLF   4KLG   4KLH   4KLI   4KLJ   4KLL   4KLM   4KLO   4KLQ   4KLS   4KLT   4KLU   4LVS   4M2Y   4M47   4M9G   4M9H   4M9J   4M9L   4M9N   4MF2   4MF8   4MFA   4MFC   4MFF   4NLK   4NLN   4NLZ   4NM1   4NM2   4NXZ   4NY8   4O5C   4O5E   4O5K   4O9M   4P2H   4PGQ   4PGX   4PGY   4PH5   4PHA   4PHD   4PHE   4PHP   4PPX   4R63   4R64   4R65   4R66   4RPX   4RPY   4RPZ   4RQ0   4RQ1   4RQ2   4RQ3   4RQ4   4RQ5   4RQ6   4RQ7   4RQ8   4RT2   4RT3   4TUP   4TUQ   4TUR   4TUS   4UAW   4UAY   4UAZ   4UB1   4UB2   4UB3   4UB4   4UB5   4UBB   4UBC   4YMM   4YMN   4YMO   4YN4   4Z6C   4Z6D   4Z6E   4Z6F   5BOL   5BOM   5BPC   5DB6   5DB7   5DB8   5DB9   5DBA   5DBB   5DBC   5EOZ   5HHH   5HHI   5J0O   5J0P   5J0Q   5J0R   5J0S   5J0T   5J0U   5J0W   5J0X   5J0Y   5J29   5J2A   5J2B   5J2C   5J2D   5J2E   5J2F   5J2G   5J2H   5J2I   5J2J   5J2K   5TB8   5TB9   5TBA   5TBB   5TBC   5TZV   5U2R   5U2S   5U2T   5U8G   5U8H   5U8I   5U9H   5UGN   5UGO   5UGP   5V1F   5V1G   5V1H   5V1I   5V1J   5V1N   5V1O   5V1P   5V1R   5VEZ   5VRW   5VRX   5VRY   5VRZ   5VS0   5VS1   5VS2   5VS3   5VS4   5WNX   5WNY   5WNZ   5WO0   7ICE   7ICF   7ICG   7ICH   7ICI   7ICJ   7ICK   7ICL   7ICM   7ICN   7ICO   7ICP   7ICQ   7ICR   7ICS   7ICT   7ICU   7ICV   8ICA   8ICB   8ICC   8ICE   8ICF   8ICG   8ICH   8ICI   8ICJ   8ICK   8ICL   8ICM   8ICN   8ICO   8ICP   8ICQ   8ICR   8ICS   8ICT   8ICU   8ICV   8ICW   8ICX   8ICY   8ICZ   9ICA   9ICB   9ICC   9ICE   9ICF   9ICG   9ICH   9ICI   9ICJ   9ICK   9ICL   9ICM   9ICN   9ICO   9ICP   9ICQ   9ICR   9ICS   9ICT   9ICU   9ICV   9ICW   9ICX   9ICY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (155)

AA Sequence

MSKRKAPQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIA      1 - 70
EKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGL     71 - 140
KYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESTKQPKL    141 - 210
LHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNK    211 - 280
NMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE                   281 - 335
//

Text Mined References (190)

PMID Year Title