Property Summary

NCBI Gene PubMed Count 26
PubMed Score 93.55
PubTator Score 20.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
esophageal adenocarcinoma -1.400 0.036
glioblastoma 2.000 0.001
osteosarcoma -2.508 0.001
adrenocortical carcinoma -1.268 0.005
tuberculosis 2.800 0.000
pancreatic ductal adenocarcinoma liver m... -1.471 0.008
intraductal papillary-mucinous adenoma (... -1.500 0.002
lung cancer 1.300 0.013
breast carcinoma -1.400 0.006
fibroadenoma -2.100 0.028
interstitial cystitis -2.000 0.001
pediatric high grade glioma 1.700 0.000
group 4 medulloblastoma -1.100 0.004
pilocytic astrocytoma 3.100 0.000
posterior fossa group A ependymoma 1.400 0.000
lung carcinoma -2.500 0.000
ductal carcinoma in situ -2.300 0.001
invasive ductal carcinoma -2.600 0.007
ovarian cancer -2.600 0.000
pituitary cancer -1.200 0.000
psoriasis 1.300 0.000

Synonym

Gene

PANTHER Protein Class (2)

PDB

1EM6   1EXV   1FA9   1FC0   1L5Q   1L5R   1L5S   1L7X   1XOI   2ATI   2QLL   2ZB2   3CEH   3CEJ   3CEM   3DD1   3DDS   3DDW  

Gene RIF (9)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify glycogen phosphorylase of liver (PYGL), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify glycogen phosphorylase of liver (PYGL), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify glycogen phosphorylase of liver (PYGL), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify glycogen phosphorylase of liver (PYGL), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17705025 Deficiency of liver glycogen phosphorylase is predominantly the result of missense mutations affecting enzyme activity. There are no common mutations and the severity of clinical symptoms varies significantly.
15223230 Observational study of genotype prevalence. (HuGE Navigator)
15223230 Susceptibility to excessive liver glycogen storage in patients with type 1 diabetes.

AA Sequence

MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIR      1 - 70
TQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRL     71 - 140
AACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHT    141 - 210
NTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVL    211 - 280
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPEL    281 - 350
MRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP    351 - 420
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPR    421 - 490
RWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP    491 - 560
SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADV    561 - 630
VNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM    631 - 700
AEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHD    701 - 770
RFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE    771 - 840
SNKVNGN                                                                   841 - 847
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22225877 2012 Acetylation negatively regulates glycogen phosphorylase by recruiting protein phosphatase 1.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...