Property Summary

Ligand Count 371
NCBI Gene PubMed Count 27
PubMed Score 98.16
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Glycogen Storage Disease Type VI 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 3.0
Disease Target Count Z-score Confidence
Glycogen storage disease VI 3 0.0 5.0
Disease Target Count Z-score Confidence
Glycogen storage disease 39 5.358 2.7
Disease Target Count
Glycogen Storage Disease 6 1

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.268 4.7e-03
adult high grade glioma 1.400 2.9e-03
Astrocytoma, Pilocytic 3.100 4.4e-11
breast carcinoma -1.400 5.9e-03
ductal carcinoma in situ -2.300 1.3e-03
esophageal adenocarcinoma -1.400 3.6e-02
fibroadenoma -2.100 2.8e-02
glioblastoma 1.900 1.9e-06
group 4 medulloblastoma -1.100 3.6e-03
interstitial cystitis -2.000 5.8e-04
intraductal papillary-mucinous adenoma (... -1.500 2.2e-03
invasive ductal carcinoma -2.600 7.2e-03
lung cancer 1.300 1.3e-02
lung carcinoma -2.500 1.5e-39
malignant mesothelioma -1.700 1.6e-07
osteosarcoma -2.508 5.7e-04
ovarian cancer -2.600 1.8e-08
pancreatic ductal adenocarcinoma liver m... -1.471 7.6e-03
pituitary cancer -1.200 3.1e-05
posterior fossa group A ependymoma 1.400 3.8e-06
psoriasis 1.300 2.8e-130
tuberculosis 2.800 3.0e-09

Gene RIF (6)

AA Sequence

MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIR      1 - 70
TQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRL     71 - 140
AACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHT    141 - 210
NTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVL    211 - 280
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPEL    281 - 350
MRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP    351 - 420
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPR    421 - 490
RWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP    491 - 560
SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADV    561 - 630
VNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM    631 - 700
AEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHD    701 - 770
RFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE    771 - 840
SNKVNGN                                                                   841 - 847
//

Text Mined References (32)

PMID Year Title