Property Summary

NCBI Gene PubMed Count 115
Grant Count 12
R01 Count 10
Funding $1,545,337.39
PubMed Score 318.54
PubTator Score 958.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.307 0.039
osteosarcoma -1.744 0.000
medulloblastoma, large-cell 1.200 0.002
group 3 medulloblastoma 1.200 0.001
psoriasis -1.300 0.000

 GWAS Trait (1)

Gene RIF (97)

PMID Text
26801967 Binding of CTLA4Fcepsilon to FcepsilonRII/CD23 appeared stronger than that of IgE
25802003 Data suggest that the protective immune response involving CD23-IgE-mediated nitric oxide release in cutaneous leishmaniasis (LCL).
25567136 Elevated serum sCD23 is associated with increased risk of non-Hodgkin lymphoma.
25155463 Human and murine P2X7 activation induces the rapid shedding of CD23 from B cells, with a potential role for ADAM10 in this process.
24639354 we have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay.
24598915 Crystal structure of the CD23-Fc3-4 complex with different molecular-packing constraints.
24354852 FCER2 polymorphism rs3760687 affects moderately elevated total serum IgE levels, especially in the absence of homozygosity for the risk allele of FCER1A SNP rs2427837.
24162774 HIV-1 gp120 downregulates the expression of Fc fragment of IgE, low affinity receptor II (FCER2; CD23) in human B cells
24102092 data indicate that the studied FCER2 variations are strongly associated with asthma susceptibility and might be risk factor among north Indian asthmatic children
24010859 CD23b-R62W-expressing human B cells bind IgE with greater affinity than wild-type cells and display differences in kinetics of CD23-mediated ERK1/2 activation
More...

AA Sequence

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKN      1 - 70
LESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLER     71 - 140
LREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFL    141 - 210
TKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAW    211 - 280
VCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS                                 281 - 321
//

Text Mined References (119)

PMID Year Title
26801967 2016 CTLA4Fc?, a novel soluble fusion protein that binds B7 molecules and the IgE receptors, and reduces human in vitro soluble CD23 production and lymphocyte proliferation.
25802003 2015 Protective Profile Involving CD23/IgE-mediated NO Release is a Hallmark of Cutaneous Leishmaniasis Patients from the Xakriabá Indigenous Community in Minas Gerais, Brazil.
25567136 2015 Elevated serum sCD23 and sCD30 up to two decades prior to diagnosis associated with increased risk of non-Hodgkin lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
25155463 2015 Activation of the P2X7 receptor induces the rapid shedding of CD23 from human and murine B cells.
24639354 2014 Critical Roles for PU.1, GATA1, and GATA2 in the expression of human Fc?RI on mast cells: PU.1 and GATA1 transactivate FCER1A, and GATA2 transactivates FCER1A and MS4A2.
24598915 2014 A range of C?3-C?4 interdomain angles in IgE Fc accommodate binding to its receptor CD23.
24354852 2014 A role of FCER1A and FCER2 polymorphisms in IgE regulation.
24102092 2013 Genetic variations of the FCER2 gene and asthma susceptibility in north Indian children: a case-control study.
24010859 2014 FCER2 (CD23) asthma-related single nucleotide polymorphisms yields increased IgE binding and Egr-1 expression in human B cells.
More...