Property Summary

Ligand Count 42
NCBI Gene PubMed Count 119
PubMed Score 325.74
PubTator Score 958.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.307 3.9e-02
group 3 medulloblastoma 1.200 1.4e-03
medulloblastoma, large-cell 1.200 1.6e-03
osteosarcoma -1.539 7.9e-06
psoriasis -1.300 2.6e-11

Gene RIF (101)

AA Sequence

MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKN      1 - 70
LESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLER     71 - 140
LREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFL    141 - 210
TKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAW    211 - 280
VCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS                                 281 - 321
//

Text Mined References (123)

PMID Year Title