Property Summary

Ligand Count 1
NCBI Gene PubMed Count 148
PubMed Score 656.74
PubTator Score 396.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.494 1.2e-07
Becker muscular dystrophy 1.082 3.7e-05
diabetes mellitus -1.500 1.3e-02
Duchenne muscular dystrophy 1.143 3.8e-09
intraductal papillary-mucinous carcinoma... 1.100 1.9e-02
limb girdle muscular dystrophy 2B 1.105 8.9e-06
lung adenocarcinoma 1.100 4.0e-05
lung cancer 1.300 2.2e-03
Multiple myeloma 1.349 4.1e-04
non-small cell lung cancer 1.230 5.9e-26
osteosarcoma 1.201 1.7e-02
ovarian cancer 2.100 9.1e-05
pancreatic cancer 1.100 9.9e-05
primary pancreatic ductal adenocarcinoma 1.056 1.8e-02
psoriasis 2.000 2.2e-05
Waldenstrons macroglobulinemia 1.066 3.7e-02

Gene RIF (82)

AA Sequence

MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN      1 - 70
KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN     71 - 140
SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE    141 - 210
GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY    211 - 280
KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV    281 - 350
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK    351 - 420
AKFAGRNFRNPLAK                                                            421 - 434
//

Text Mined References (163)

PMID Year Title