Property Summary

NCBI Gene PubMed Count 141
Grant Count 36
R01 Count 7
Funding $3,451,417.58
PubMed Score 633.56
PubTator Score 396.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (80)

PMID Text
26882120 ENO1 was demonstrated to be up-regulated by HIF-1alpha in retinal pigment epithelial cells in response to hypoxia, without influencing VEGF secretion.
26432922 An immune-modulatory role has been proposed for surface alpha-enolase and our findings of decreased expression suggest that deficits in surface alpha-enolase merit investigation in the context of immune dysfunction during ageing and vascular disease
26144282 Data suggest that endoplasmic reticulum stress up-regulates ENO1/MBP1 expression through the AKT/PERK/eIF2a signaling axis in both breast cancer cells and non-tumor cells.
26097998 ENO1 induces gene expression, lactate production, cell proliferation and migration and can be negatively regulated by FBXW7 at the posttranslational level.
26037892 Low ENO1 expression is associated with clear cell renal cell carcinoma.
26024773 ENO1 is an independent prognostic factor, significantly correlated with overall survival of Non-Hodgkin's Lymphoma patients.
25978602 Systems biology approach reveals possible evolutionarily conserved moonlighting functions for enolase
25951350 In this study, ENO1 silencing significantly reduced cell glycolysis, proliferation, migration, and invasion in vitro, as well as tumorigenesis and metastasis in vivo by modulating p85 suppression.
25944790 alpha-Enolase increases after injury and may activate pulmonary endothelial cells and prime PMNs through plasmin activity and PAR-2 activation
25918939 tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)
More...

AA Sequence

MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN      1 - 70
KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN     71 - 140
SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE    141 - 210
GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY    211 - 280
KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV    281 - 350
TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK    351 - 420
AKFAGRNFRNPLAK                                                            421 - 434
//

Text Mined References (155)

PMID Year Title
26882120 2016 Up-Regulation of ENO1 by HIF-1? in Retinal Pigment Epithelial Cells after Hypoxic Challenge Is Not Involved in the Regulation of VEGF Secretion.
26432922 2015 CD4(+) T cell surface alpha enolase is lower in older adults.
26144282 2015 Cellular stress induces cap-independent alpha-enolase/MBP-1 translation.
26097998 2015 FBXW7 negatively regulates ENO1 expression and function in colorectal cancer.
26037892 2015 Alpha-enolase is a potential prognostic marker in clear cell renal cell carcinoma.
26024773 2015 ENO1 promotes tumor proliferation and cell adhesion mediated drug resistance (CAM-DR) in Non-Hodgkin's Lymphomas.
25978602 2015 Systems biology approach reveals possible evolutionarily conserved moonlighting functions for enolase.
25951350 2015 Enolase-1 is a therapeutic target in endometrial carcinoma.
25944790 2015 ?-Enolase Causes Proinflammatory Activation of Pulmonary Microvascular Endothelial Cells and Primes Neutrophils Through Plasmin Activation of Protease-Activated Receptor 2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...