Property Summary

NCBI Gene PubMed Count 91
PubMed Score 281.96
PubTator Score 295.83

Knowledge Summary

Patent (18,981)

Expression

  Differential Expression (4)

Disease log2 FC p
gastric carcinoma -4.000 6.5e-03
lung adenocarcinoma 1.200 2.5e-03
medulloblastoma, large-cell 1.500 5.3e-03
psoriasis -2.500 4.8e-47

Protein-protein Interaction (2)

Gene RIF (70)

AA Sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM      1 - 70
TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY     71 - 140
TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV    211 - 280
LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV    281 - 350
QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK                                           351 - 381
//

Text Mined References (91)

PMID Year Title