Property Summary

NCBI Gene PubMed Count 84
Grant Count 78
R01 Count 38
Funding $12,307,358.48
PubMed Score 276.33
PubTator Score 295.83

Knowledge Summary

Patent (18,981)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.500 0.005
lung adenocarcinoma 1.200 0.002
gastric carcinoma -4.000 0.007
psoriasis -2.500 0.000

Synonym

Accession P06732 Q96QL9
Symbols CKMM
M-CK

Gene

CKM

PANTHER Protein Class (3)

PDB

1I0E  

Gene RIF (63)

PMID Text
26738403 Data show that a low serum creatine kinase activity is more common in female than male, and is associated with older age.
26118042 The serum expression levels of myocardial creatine kinase and of galectin-3 reflect the physiopathology state of children with congenital heart defects after surgical correction.
26027379 Based on the obtained results, it may be speculated that the CKM A/G polymorphism is not an important determinant of endurance performance level in Polish and Russian rowers.
25802449 CK-MB mass is more significant criteria of myocardial injury.
25214527 The variant rs11559024 in the CKM gene (Glu83Gly) was significantly associated with CK levels of statin users.
25141318 CK-MB levels were higher after ERCP in non-ischemic patients compared with a myocardial ischemia group. Creatine phosphokinase levels did not differ significantly between groups.
24846126 serum CK-MB elevated in underweight hemodialysis patients
24673369 Asymptomatic hyper-CKemia is an uncommon association with hyponatremia of various etiologies.
24625749 troponin T and creatinine kinase isoenzyme (CK-MB) have roles in combined renal and myocardial injuries in asphyxiated infants
24602118 Substantive creatine phosphokinase increases and rhabdomyolysis with statin use were particularly seen in patients starting treatment, those on large daily doses or interacting drugs or with larger numbers of concomitant drugs
More...

AA Sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM      1 - 70
TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY     71 - 140
TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD    141 - 210
WPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV    211 - 280
LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV    281 - 350
QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK                                           351 - 381
//

Text Mined References (84)

PMID Year Title
26738403 2015 Low serum creatine kinase activity in hospital patients.
26118042 [BIOCHEMICAL MARKERS OF MYOCARDIAL DAMAGE IN CHILDREN AFTER SURGICAL CORRECTION OF CONGENITAL HEART DISEASE].
26027379 2015 CKM gene polymorphism in Russian and Polish rowers.
25802449 2015 Study of CK-MB activity in patients with acute myocardial infarction after percutaneous coronary intervention.
25416956 2014 A proteome-scale map of the human interactome network.
25214527 2014 CKM and LILRB5 are associated with serum levels of creatine kinase.
25141318 2014 Role of serum myeloperoxidase, CPK, CK-MB, and cTnI tests in early diagnosis of myocardial ischemia during ERCP.
24846126 2014 A comparison of markers of myocardial injury and their relation to nutritional parameters in hemodialysis patients.
24673369 2014 Asymptomatic elevation of creatine kinase in patients with hyponatremia.
24625749 2014 The diagnostic value of both troponin T and creatinine kinase isoenzyme (CK-MB) in detecting combined renal and myocardial injuries in asphyxiated infants.
More...