Property Summary

NCBI Gene PubMed Count 166
Grant Count 329
R01 Count 138
Funding $62,703,051.03
PubMed Score 8916.76
PubTator Score 278.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P06731 H9KVA7
Symbols CEA
CD66e

Gene

PDB

1E07   2QSQ   2QST   2VER  

Gene RIF (134)

PMID Text
27100181 High carcinoembryonic antigen expression is associated with Colon Adenomas.
27069188 The multivariate stepwise logistic regression identified the following biomarkers as the best gastric cancer predictors: CEA, CA72-4, pepsinogen I, Helicobacter pylori presence and MMP7
26962798 combined pre-chemoradiotherapy CEA and post-chemoradiotherapy CEA levels enable more accurate prediction of rectal adenocarcinoma prognosis
26708917 ESCC patients with lower Cyfra21-1 and CEA, higher miR-7 and severe myelosuppression were much more sensitive to CRT.
26673628 show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6
26559272 level predicts pathologic complete response in rectal cancer treatment
26374829 CEACAM5 expression was increased progressively from normal gastric mucosa to chronic atrophic gastritis, intestinal metaplasia, dysplasia and finally to gastric cancer.
26339655 Among patients with elevated concentrations of the CA 15-3, CEA, and TPA concordance could be observed between serial changes of the hypermethylated RASSF1A gene and the protein markers
26333429 Serum CYFRA21-1 and CEA can be used as prognostic factors of NSCLC patients. Combinative detection of the two indices will be more reliable.
26301886 Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA.
More...

AA Sequence

MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKG      1 - 70
ERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRV     71 - 140
YPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDT    141 - 210
ASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQS    211 - 280
TQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQ    281 - 350
NTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI    351 - 420
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTT    421 - 490
VKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFN    491 - 560
VTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRIN    561 - 630
GIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVA    631 - 700
LI                                                                        701 - 702
//

Text Mined References (168)

PMID Year Title
27100181 2016 Mutational Profiles Reveal an Aberrant TGF-?-CEA Regulated Pathway in Colon Adenomas.
27069188 2016 Searching for New Biomarkers and the Use of Multivariate Analysis in Gastric Cancer Diagnostics.
26962798 2016 Prognosis Can Be Predicted More Accurately Using Pre- and Postchemoradiotherapy Carcinoembryonic Antigen Levels Compared to Only Prechemoradiotherapy Carcinoembryonic Antigen Level in Locally Advanced Rectal Cancer Patients Who Received Neoadjuvant Chemoradiotherapy.
26708917 2016 Diagnostic and predictive significance of serum microRNA-7 in esophageal squamous cell carcinoma.
26673628 2015 Interleukin-6 trans-signaling increases the expression of carcinoembryonic antigen-related cell adhesion molecules 5 and 6 in colorectal cancer cells.
26559272 2015 Predictors of Pathologic Complete Response in Rectal Cancer Patients Undergoing Total Mesorectal Excision After Preoperative Chemoradiation.
26374829 2015 Identification of CEACAM5 as a Biomarker for Prewarning and Prognosis in Gastric Cancer.
26339655 2015 Concordance of Hypermethylated DNA and the Tumor Markers CA 15-3, CEA, and TPA in Serum during Monitoring of Patients with Advanced Breast Cancer.
26333429 2015 Prognostic value of serum CYFRA21-1 and CEA for non-small-cell lung cancer.
26301886 2015 Evaluation of serum and pleural levels of soluble B7-H4 in lung cancer patients with pleural effusion.
More...