Property Summary

NCBI Gene PubMed Count 266
Grant Count 418
R01 Count 290
Funding $44,257,604.47
PubMed Score 1004.43
PubTator Score 796.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.100 0.003
ependymoma -2.500 0.001
oligodendroglioma -2.200 0.003
glioblastoma -2.800 0.000
osteosarcoma -1.222 0.014
sonic hedgehog group medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -2.000 0.000
tuberculosis -1.500 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.300 0.000
subependymal giant cell astrocytoma -2.360 0.011
ovarian cancer 1.200 0.000

Synonym

Accession P06730 B7Z6V1 D6RCQ6 Q96E95 eIF-4E
Symbols CBP
EIF4F
AUTS19
EIF4E1
eIF-4E
EIF4EL1

Gene

PDB

1WKW   2V8W   2V8X   2V8Y   3U7X   4UED   5EKV   3AM7   2W97   4AZA   5EHC   1IPB   1IPC   2GPQ   3TF2   4BEA   4DT6   4DUM   4TPW   4TQB   4TQC   5ABI   5EI3   5EIR  

Gene RIF (194)

PMID Text
26945967 Activated eIF4E, which is phosphorylated by MNK1, is a regulator of Sox2 expression after irradiation of pancreatic tumor cells.
26944016 Our findings identify the eIF4E- beta-catenin axis as a critical regulator of lung cancer cell growth and survival, and suggest that its pharmacological inhibition may be therapeutically useful in lung cancer.
26668315 Data suggest MNK1/MNK2 stimulate mRNA translation but only of mRNA containing both 5-prime-terminal cap and hairpin duplex; this stimulation involves up-regulation of phosphorylation/mRNA un-winding activity of eIF4E (via decreased binding to eIF4G).
26572974 This review will present eIF4E's structure and functions. It will also expose the use of eIF4E as a therapeutic target in cancer
26498997 This study demonstrates that the activation of eIF4E gene is an essential component of the malignant phenotype in ovarian cancer
26427906 Report the presence of a cryptic pocket at the protein-binding interface of eIF4E, which opens transiently during molecular dynamics simulations of the protein in solvent water and is observed to be stable when water is mixed with benzene molecules.
26397141 mechanistic analysis suggested that LMP1 overexpression induced the expression of eIF4E, while eIF4E-shRNA dramatically attenuated the increase in cell proliferation, invasion, migration and the inhibition of apoptosis triggered by LMP-1 upregulation
26147685 Data show that interferon-gamma regulated the metabolism and mRNA translation of macrophages by targeting the kinases mTORC1 and MNK1/2, both of which converge on the selective regulator of translation initiation eukaryotic initiation factor-4E (eIF4E).
26143374 Data suggest that targets of RNA interference via MIRN206 (microRNA 206) include EIF4E (eukaryotic initiation factor-4E) and MET (proto-oncogene c-met), in addition to PAX3 (paired box gene 3) and SNX2 (sorting nexin 2).
26078354 Findings provide new evidence that PRMT5 plays an important role in CRC pathogenesis through epigenetically regulating arginine methylation of oncogenes such as eIF4E and FGFR3.
More...

AA Sequence

MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVE      1 - 70
DFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGE     71 - 140
SFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGST    141 - 210
TKNRFVV                                                                   211 - 217
//

Text Mined References (274)

PMID Year Title
27117702 2016 The m(6)A Methyltransferase METTL3 Promotes Translation in Human Cancer Cells.
26945967 2016 eIF4E-phosphorylation-mediated Sox2 upregulation promotes pancreatic tumor cell repopulation after irradiation.
26944016 2016 Antibiotic drug rifabutin is effective against lung cancer cells by targeting the eIF4E-?-catenin axis.
26668315 2016 Inhibition of Mitogen-activated Protein Kinase (MAPK)-interacting Kinase (MNK) Preferentially Affects Translation of mRNAs Containing Both a 5'-Terminal Cap and Hairpin.
26572974 2015 The Eukaryotic Translation Initiation Factor 4E (eIF4E) as a Therapeutic Target for Cancer.
26498997 2015 Knockdown of eIF4E suppresses cell proliferation, invasion and enhances cisplatin cytotoxicity in human ovarian cancer cells.
26427906 2015 Gating by tryptophan 73 exposes a cryptic pocket at the protein-binding interface of the oncogenic eIF4E protein.
26397141 2015 LMP1 promotes nasal NK/T-cell lymphoma cell function by eIF4E via NF-?B pathway.
26147685 2015 Interferon-? regulates cellular metabolism and mRNA translation to potentiate macrophage activation.
26143374 2015 Identification of the receptor tyrosine kinases (RTKs)-oriented functional targets of miR-206 by an antibody-based protein array.
More...