Property Summary

Ligand Count 17
NCBI Gene PubMed Count 310
PubMed Score 1064.09
PubTator Score 796.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.100 2.6e-05
astrocytic glioma -2.100 3.0e-03
Astrocytoma, Pilocytic -2.300 9.4e-09
atypical teratoid / rhabdoid tumor -2.900 2.2e-10
ependymoma -2.500 1.2e-03
glioblastoma -2.300 5.0e-11
group 3 medulloblastoma -1.600 4.5e-03
medulloblastoma, large-cell -2.400 6.2e-06
oligodendroglioma -2.200 3.2e-03
osteosarcoma -1.222 1.4e-02
ovarian cancer 1.200 4.5e-06
primitive neuroectodermal tumor -2.000 1.7e-05
subependymal giant cell astrocytoma -2.360 1.1e-02
tuberculosis -1.500 3.6e-06

PDB (25)

Gene RIF (227)

AA Sequence

MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVE      1 - 70
DFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGE     71 - 140
SFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGST    141 - 210
TKNRFVV                                                                   211 - 217
//

Text Mined References (317)

PMID Year Title