Property Summary

NCBI Gene PubMed Count 91
Grant Count 395
R01 Count 190
Funding $52,184,058.59
PubMed Score 2389.78
PubTator Score 2465.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.100 0.007
cutaneous lupus erythematosus 3.000 0.000
psoriasis 1.900 0.000
osteosarcoma -2.235 0.011
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 1.600 0.001
medulloblastoma, large-cell 1.500 0.000
lung cancer -1.300 0.001
sarcoidosis 1.200 0.030
interstitial cystitis 1.800 0.003
adult high grade glioma 2.000 0.000
pilocytic astrocytoma 1.100 0.008
primary Sjogren syndrome 2.200 0.000
subependymal giant cell astrocytoma 1.302 0.031
invasive ductal carcinoma 1.181 0.018
lung carcinoma -1.400 0.000
ulcerative colitis 1.600 0.000

Synonym

Accession P06729 Q96TE5
Symbols T11
SRBC
LFA-2

Gene

CD2

PDB

2J6O   2J7I   1QA9   1CDB   1GYA   1HNF   1L2Z  

Gene RIF (49)

PMID Text
26041540 CD58/CD2 is the primary costimulatory pathway in human CD28-CD8+ T cells.
25984915 the fundamental mechanism of glycosylation of human CD2 is to promote CD2-CD58 binding by conformational adjustment of CD2
25402852 Although sMCs displayed immunoreactivity for one of the neoplastic antigens in the majority of SM patients, the aberrant CD2 and/or CD25 expression on sMCs is not as indicative of SM as the BMMC immunophenotype.
24597656 Both the mRNA expression levels and protein expression levels of HSP27 were increased in astrocytes from POAG patients compared with those from normal control, suggesting that mutation in CD2 might pose a risk for POAG in Chinese population.
24072102 ERGdel may be a pure surrogate of CD2-positivity--which has been suggested to be a good prognositc marker in childhood ALL
23760244 Altogether, these results show that a high CD2 expression level is a hallmark of latently infected resting memory CD4(+) T cells in vivo.
23112830 CD2-CD58/48 receptor-ligand interaction promotes and is required for nanotube formation in human natural killer cells.
22634534 Aberrant CD2 expression appears to further determine a shorter progression free survival
22222639 CD2 expression does not contribute to improve the diagnosis of systemic mastocytosis when compared with aberrant CD25 expression alone.
22084431 CD2-mediated priming of resting natural killer (NK) cells is unaffected by their degree of functional maturation.
More...

AA Sequence

MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ      1 - 70
FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI     71 - 140
NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI    141 - 210
YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQ    211 - 280
HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS    281 - 350
N//

Text Mined References (92)

PMID Year Title
27117418 2016 Critical Role of CD2 Co-stimulation in Adaptive Natural Killer Cell Responses Revealed in NKG2C-Deficient Humans.
26791160 2016 A CD2 high-expressing stress-resistant human plasmacytoid dendritic-cell subset.
26041540 2015 CD58/CD2 Is the Primary Costimulatory Pathway in Human CD28-CD8+ T Cells.
25984915 2015 Glycosylation Modulates Human CD2-CD58 Adhesion via Conformational Adjustment.
25402852 2014 Does the aberrant expression of CD2 and CD25 by skin mast cells truly correlate with systemic involvement in patients presenting with mastocytosis in the skin?
24597656 2014 Family-based analysis identified CD2 as a susceptibility gene for primary open angle glaucoma in Chinese Han population.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24072102 2014 ERG deletion is associated with CD2 and attenuates the negative impact of IKZF1 deletion in childhood acute lymphoblastic leukemia.
23760244 2013 High levels of CD2 expression identify HIV-1 latently infected resting memory CD4+ T cells in virally suppressed subjects.
23663663 2013 Multimeric and differential binding of CIN85/CD2AP with two atypical proline-rich sequences from CD2 and Cbl-b*.
More...