Property Summary

Ligand Count 2
NCBI Gene PubMed Count 92
PubMed Score 2422.49
PubTator Score 2465.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.800 4.0e-03
adult high grade glioma 2.000 4.7e-04
atypical teratoid / rhabdoid tumor 1.500 1.0e-03
cutaneous lupus erythematosus 3.000 2.5e-04
gastric cancer 1.100 7.0e-03
glioblastoma 1.600 6.5e-04
interstitial cystitis 1.800 2.5e-03
invasive ductal carcinoma 1.181 1.8e-02
lung cancer -1.300 1.2e-03
lung carcinoma -1.400 1.2e-12
medulloblastoma, large-cell 1.500 7.3e-05
osteosarcoma -2.235 1.1e-02
Pilocytic astrocytoma 1.100 8.1e-03
primary Sjogren syndrome 2.200 2.3e-05
sarcoidosis 1.200 3.0e-02
subependymal giant cell astrocytoma 1.302 3.1e-02
ulcerative colitis 1.600 6.4e-05

Gene RIF (48)

AA Sequence

MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ      1 - 70
FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI     71 - 140
NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI    141 - 210
YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQ    211 - 280
HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS    281 - 350
N//

Text Mined References (93)

PMID Year Title