Property Summary

NCBI Gene PubMed Count 193
PubMed Score 211.82
PubTator Score 380.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-04
pancreatic ductal adenocarcinoma liver m... -1.557 1.0e-02

Protein-protein Interaction (2)

Gene RIF (152)

AA Sequence

MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVN      1 - 70
TYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYAD     71 - 140
QLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKV    141 - 210
KIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG    211 - 280
NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDK    281 - 350
VNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES                            351 - 396
//

Text Mined References (196)

PMID Year Title