Property Summary

NCBI Gene PubMed Count 183
Grant Count 71
R01 Count 55
Funding $5,759,190.2
PubMed Score 204.24
PubTator Score 380.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.557 0.010
adult high grade glioma -1.200 0.000

Synonym

Accession P06727 A8MSL6 Q14CW8 Q6Q787 Apo-AIV
Symbols

Gene

PDB

3S84  

Gene RIF (146)

PMID Text
26556724 ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose.
26491253 Low levels of APOA1, APOC3, and APOA4 are associated with risk of Alzheimer disease.
26485402 the present findings reveal that High-altitude polycythemia -induced gastric mucosal lesion inspires the protection responses by up-regulating APOA4 and APOC3, and down-regulating GIF.
26397108 Single nucleotide polymorphisms (Rs7396835) of APOA4 protein did not increase the risk of CHD in the Chinese population.
25733664 the systematic conversion of conserved prolines to alanine increased the thermodynamic stability of apoA-IV and its propensity to oligomerize
25463085 analysis of methylation patterns of the APOA1/C3/A4/A5 cluster that may be directly involved in the transcriptional regulation of this cluster, especially in liver
24606699 Human papillomavirus E5 oncoproteins bind the A4 in endoplasmic reticulum to regulate proliferative ability upon differentiation.
24598141 transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH
24425874 The structure of human apolipoprotein A-IV as revealed by stable isotope-assisted cross-linking, molecular dynamics, and small angle x-ray scattering.
24311788 apoA-IV inhibits hepatic gluconeogenesis by decreasing Glc-6-Pase and PEPCK gene expression through NR1D1.
More...

AA Sequence

MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVN      1 - 70
TYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYAD     71 - 140
QLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKV    141 - 210
KIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG    211 - 280
NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDK    281 - 350
VNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES                            351 - 396
//

Text Mined References (187)

PMID Year Title
26556724 2015 Interaction of ApoA-IV with NR4A1 and NR1D1 Represses G6Pase and PEPCK Transcription: Nuclear Receptor-Mediated Downregulation of Hepatic Gluconeogenesis in Mice and a Human Hepatocyte Cell Line.
26491253 2015 Decreased expression of the APOA1-APOC3-APOA4 gene cluster is associated with risk of Alzheimer's disease.
26485402 2015 Transcriptome Reveals 1400-Fold Upregulation of APOA4-APOC3 and 1100-Fold Downregulation of GIF in the Patients with Polycythemia-Induced Gastric Injury.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
25733664 2015 Role of Conserved Proline Residues in Human Apolipoprotein A-IV Structure and Function.
25463085 2014 Tissue-specific DNA methylation profiles regulate liver-specific expression of the APOA1/C3/A4/A5 cluster and can be manipulated with demethylating agents on intestinal cells.
24606699 2014 Human papillomavirus E5 oncoproteins bind the A4 endoplasmic reticulum protein to regulate proliferative ability upon differentiation.
24598141 2014 Transcriptional regulation of apolipoprotein A-IV by the transcription factor CREBH.
24425874 2014 The structure of human apolipoprotein A-IV as revealed by stable isotope-assisted cross-linking, molecular dynamics, and small angle x-ray scattering.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
More...