Property Summary

NCBI Gene PubMed Count 96
PubMed Score 494.37
PubTator Score 324.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 1.62206712924307E-27
Duchenne muscular dystrophy 602 1.88167304441233E-10
juvenile dermatomyositis 1189 6.55294148868498E-8
limb girdle muscular dystrophy 2A 156 2.50867293704524E-7
ovarian cancer 8492 1.40768099385433E-6
pituitary cancer 1972 2.12657934615431E-6
lung cancer 4473 6.01650517530225E-6
osteosarcoma 7933 7.37250993488806E-6
posterior fossa group A ependymoma 1511 8.55032679130542E-6
pilocytic astrocytoma 3086 1.89556606545072E-5
Becker muscular dystrophy 187 3.60114352573641E-5
group 4 medulloblastoma 1875 3.11841455446262E-4
psoriasis 6685 3.55689383226713E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.49478830290629E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.35457233863728E-4
pancreatic cancer 2300 0.00132670235333421
Breast cancer 3099 0.00149030912323218
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00227462812335835
subependymal giant cell astrocytoma 2287 0.00367396061884053
adult high grade glioma 2148 0.00381583258083361
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00678126067641913
urothelial carcinoma 318 0.0076338501752841
adrenocortical carcinoma 1427 0.00931769250317332
medulloblastoma, large-cell 6234 0.0194396855367971
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0207869464389741
invasive ductal carcinoma 2950 0.0355200966273949
gastric carcinoma 832 0.0468678769201339

Expression

Synonym

Accession P06703 D3DV39 Q5RHS4
Symbols 2A9
PRA
5B10
CABP
CACY

Gene

PDB

2M1K   4YBH   1K8U   1K96   1K9K   1K9P  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (64)

PMID Text
26646427 findings strongly suggest that S100A6 may promote OS cell proliferation and OS tumor growth at least in part by facilitating cell cycle progression, preventing apoptosis, and inhibiting osteogenic differentiation
26238340 Weak or absent S100A6 staining supports a diagnosis of pilar leiomyoma, whereas strong positive staining supports a diagnosis of cutaneous leiomyosarcoma.
25799022 S100A6 induces EMT and promotes cell migration and invasion in a beta-catenin-dependent manner.
25760073 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25743341 Applying this serum marker to clinical practice would require less-invasive examinations of patients and would help to detect life-threatening cancerous lesions earlier than current modalities.
25450463 Results obtained proved that increased S100A6 content in keratinocytes dramatically changed the pace and extent of epidermal differentiation
25256682 Data indicate that the interaction between S100A6 and integrin beta1, was confirmed by ELISA.
25120023 High-level S100A6 promotes metastasis and predicts the outcome of T1-T2 stage in clear cell renal cell carcinoma
24746261 In Wharton's jelly of preeclamptic tissue S100 calcium binding protein A6(S100A6) is up-regulated and binds to different targets than in control suggesting involvement in development of preeclampsia
24378749 our results suggest that the cellular effects of S100A6 are mediated by the ERK and p38 MAPK pathways, and modulation of these pathways may be employed for CRC prevention and therapy.
More...

AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF      1 - 70
QEYVTFLGALALIYNEALKG                                                       71 - 90
//

Text Mined References (103)

PMID Year Title
26646427 2015 The Calcium-Binding Protein S100A6 Accelerates Human Osteosarcoma Growth by Promoting Cell Proliferation and Inhibiting Osteogenic Differentiation.
26238340 2015 S100A6 expression in cutaneous smooth muscle neoplasms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799022 2015 S100 calcium-binding protein A6 promotes epithelial-mesenchymal transition through ?-catenin in pancreatic cancer cell line.
25760073 2015 Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25743341 2014 Serum expression of S100A6 is a potential detection marker in patients with urothelial carcinoma in the urinary bladder.
25450463 2014 S100A6 expression in keratinocytes and its impact on epidermal differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
25256682 2014 S100A6 is secreted from Wharton's jelly mesenchymal stem cells and interacts with integrin ?1.
25120023 2015 High-level S100A6 promotes metastasis and predicts the outcome of T1-T2 stage in clear cell renal cell carcinoma.
More...