Property Summary

NCBI Gene PubMed Count 96
Grant Count 195
R01 Count 134
Funding $27,584,776.75
PubMed Score 494.37
PubTator Score 324.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P06703 D3DV39 Q5RHS4
Symbols 2A9
PRA
5B10
CABP
CACY

Gene

PDB

2M1K   4YBH   1K8U   1K96   1K9K   1K9P  

Gene RIF (64)

PMID Text
26646427 findings strongly suggest that S100A6 may promote OS cell proliferation and OS tumor growth at least in part by facilitating cell cycle progression, preventing apoptosis, and inhibiting osteogenic differentiation
26238340 Weak or absent S100A6 staining supports a diagnosis of pilar leiomyoma, whereas strong positive staining supports a diagnosis of cutaneous leiomyosarcoma.
25799022 S100A6 induces EMT and promotes cell migration and invasion in a beta-catenin-dependent manner.
25760073 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25743341 Applying this serum marker to clinical practice would require less-invasive examinations of patients and would help to detect life-threatening cancerous lesions earlier than current modalities.
25450463 Results obtained proved that increased S100A6 content in keratinocytes dramatically changed the pace and extent of epidermal differentiation
25256682 Data indicate that the interaction between S100A6 and integrin beta1, was confirmed by ELISA.
25120023 High-level S100A6 promotes metastasis and predicts the outcome of T1-T2 stage in clear cell renal cell carcinoma
24746261 In Wharton's jelly of preeclamptic tissue S100 calcium binding protein A6(S100A6) is up-regulated and binds to different targets than in control suggesting involvement in development of preeclampsia
24378749 our results suggest that the cellular effects of S100A6 are mediated by the ERK and p38 MAPK pathways, and modulation of these pathways may be employed for CRC prevention and therapy.
More...

AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF      1 - 70
QEYVTFLGALALIYNEALKG                                                       71 - 90
//

Text Mined References (103)

PMID Year Title
26646427 2015 The Calcium-Binding Protein S100A6 Accelerates Human Osteosarcoma Growth by Promoting Cell Proliferation and Inhibiting Osteogenic Differentiation.
26238340 2015 S100A6 expression in cutaneous smooth muscle neoplasms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25799022 2015 S100 calcium-binding protein A6 promotes epithelial-mesenchymal transition through ?-catenin in pancreatic cancer cell line.
25760073 2015 Elevated S100A6 (Calcyclin) enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma.
25743341 2014 Serum expression of S100A6 is a potential detection marker in patients with urothelial carcinoma in the urinary bladder.
25450463 2014 S100A6 expression in keratinocytes and its impact on epidermal differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
25256682 2014 S100A6 is secreted from Wharton's jelly mesenchymal stem cells and interacts with integrin ?1.
25120023 2015 High-level S100A6 promotes metastasis and predicts the outcome of T1-T2 stage in clear cell renal cell carcinoma.
More...