Property Summary

NCBI Gene PubMed Count 105
PubMed Score 530.52
PubTator Score 324.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.9

Expression

  Differential Expression (27)

Gene RIF (72)

AA Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF      1 - 70
QEYVTFLGALALIYNEALKG                                                       71 - 90
//

Text Mined References (112)

PMID Year Title