Property Summary

NCBI Gene PubMed Count 378
PubMed Score 470.90
PubTator Score 599.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.548 3.1e-02
acute quadriplegic myopathy 1.458 8.2e-03
Atopic dermatitis 4.900 6.2e-05
breast carcinoma 1.400 3.6e-10
chronic lymphosyte leukemia -3.100 3.1e-10
chronic rhinosinusitis 1.962 3.1e-02
cutaneous lupus erythematosus 4.200 6.3e-04
cystic fibrosis and chronic rhinosinusit... 1.528 1.4e-02
dermatomyositis 1.200 3.2e-02
esophageal adenocarcinoma -3.700 2.6e-02
gastric carcinoma 1.800 4.6e-02
glioblastoma 2.100 4.9e-02
interstitial cystitis 1.900 5.9e-03
intraductal papillary-mucinous adenoma (... -1.300 4.0e-04
lung cancer -3.800 4.1e-02
lung carcinoma -2.000 5.9e-16
medulloblastoma, large-cell -1.800 9.1e-04
mucosa-associated lymphoid tissue lympho... 3.719 7.5e-03
nasopharyngeal carcinoma -3.000 4.3e-04
osteosarcoma -3.983 2.3e-03
ovarian cancer -1.800 3.3e-03
psoriasis 6.600 5.6e-11
tuberculosis 2.500 1.3e-07
ulcerative colitis 3.500 2.4e-07
uncontrolled asthma -1.300 3.4e-02

Protein-protein Interaction (6)

Gene RIF (332)

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA      1 - 70
DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP                               71 - 114
//

Text Mined References (398)

PMID Year Title