Property Summary

NCBI Gene PubMed Count 309
Grant Count 47
R01 Count 30
Funding $5,391,146.49
PubMed Score 459.43
PubTator Score 599.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene RIF (264)

PMID Text
27071448 Fecal calprotectin is correlated with the extent of affected mucosa as well as severity in ulcerative colitis patients.
26788548 Downregulation of S100A9 was observed in 67% of 288 different esophageal squamous cell carcinoma tumors.
26768632 Data indicate that fecal calprotectin (FC) concentration can be a noninvasive marker of disease activity in inflammatory bowel diseases (IBD).
26759247 Elevated fecal calprotectin levels in primary Sjogren's syndrome was associated with concomitant gastrointestinal disease.
26745257 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma
26745147 Urinary calprotectin concentrations start rising within 2 hours after ischaemia/reperfusion-induced kidney injury.
26713053 The TSPAN13-to-S100A9 ratio was selected to determine the diagnostic value of urinary nucleic acids in prostate cancer (PCa) (P = 0.037) and shown to be significantly higher in PCa than in benign prostatic hyperplasia.
26653550 the findings support the putative diagnostic value of S100A9 measurement in serum as a marker for breast cancer
26603731 Current evidence suggests that serum calprotectin is significantly raised among women with preeclampsia during the third trimester
26448179 S100A9 could be viewed as a novel therapeutic target for patients with ER(-)PgR(-) breast cancers.
More...

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA      1 - 70
DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP                               71 - 114
//

Text Mined References (329)

PMID Year Title
27071448 2016 Fecal calprotectin level correlated with both endoscopic severity and disease extent in ulcerative colitis.
26788548 2015 Downregulation of S100 Calcium Binding Protein A9 in Esophageal Squamous Cell Carcinoma.
26768632 Fecal Calprotectin as an Activity Marker of Inflammatory Bowel Disease in Children.
26759247 2016 Elevated levels of faecal calprotectin in primary Sjögren's syndrome is common and associated with concomitant organic gastrointestinal disease.
26745257 2015 Serum S100A8 and S100A9 Enhance Innate Immune Responses in the Pathogenesis of Baker's Asthma.
26745147 2016 Dynamics of Urinary Calprotectin after Renal Ischaemia.
26713053 2015 Urinary Nucleic Acid TSPAN13-to-S100A9 Ratio as a Diagnostic Marker in Prostate Cancer.
26653550 2015 Diagnostic importance of S100A9 and S100A12 in breast cancer.
26603731 2016 An evaluation of calprotectin as serum marker of preeclampsia: a systematic review of observational studies.
26448179 2015 S100A9 expressed in ER(-)PgR(-) breast cancers induces inflammatory cytokines and is associated with an impaired overall survival.
More...