Property Summary

NCBI Gene PubMed Count 110
Grant Count 69
R01 Count 26
Funding $17,610,045.97
PubMed Score 88.61
PubTator Score 34339.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer -1.138 0.000
active Crohn's disease 2.264 0.000
subependymal giant cell astrocytoma 3.120 0.004

Synonym

Accession P06681 B4DPF3 B4DV20 E9PFN7 O19694 Q13904
Symbols CO2
ARMD14

Gene

C2

PDB

2I6Q   2I6S   2ODP   2ODQ   3ERB  

Gene RIF (66)

PMID Text
26176736 The rs2844455 A allele of C2 is a risk factor for systemic lupus erythematosus development in a Chinese population, whereas the G allele might be a protective factor.
25732348 our data indicate that C2 rs547154 polymorphism plays a protective role in the development of PCV.
24983375 Inhibition of c3 convertase activity by hepatitis C virus as an additional lesion in the regulation of complement components.
24965207 The C2 and CFB gene variants were shown to be associated with polypoidal CNV. Typical PCV was not associated with variants in these genes.
24519512 The rs547154, rs641153, and rs12614 SNPs were not associated with age-related macular degeneration development in Greek patients.
24453474 ARMS2 and C3 are major contributors to advanced age-related macular degeneration in Mexican patients, while the contributions of CFH, C2, and CFB are minor to those of other populations.
23233260 Gene variants in CFH and C2/CFB contribute to age related macular degeneration in the Chinese population.
23060141 CFH (RS1061170), C2 (RS547154), OR CFB (RS438999) was not associated with early or late AMD.
22869612 This meta-analysis provides evidence for an association between C2/CFB polymorphisms and age-related macular degeneration.
22610944 Results showed that missense mutations in transmembrane protein 2 p.Ser1254Asn, interferon alpha 2 p.Ala120Thr, its regulator NLR family member X1 p.Arg707Cys, and complement component 2 p.Glu318Asp were associated with chronic hepatitis B.
More...

AA Sequence

MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQW      1 - 70
QTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGE     71 - 140
TAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSY    141 - 210
DFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLM    211 - 280
VDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMM    281 - 350
NNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW    351 - 420
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKPKSQE    421 - 490
TCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGD    491 - 560
DIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLK    561 - 630
MGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWG    631 - 700
LYNPCLGSADKNSRKRAPRSKVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL                      701 - 752
//

Text Mined References (114)

PMID Year Title
26176736 2015 Genetic association of complement component 2 polymorphism with systemic lupus erythematosus.
25732348 2015 C2 rs547154 polymorphism and polypoidal choroidal vasculopathy susceptibility: a meta-analysis.
24983375 2014 Inhibition of c3 convertase activity by hepatitis C virus as an additional lesion in the regulation of complement components.
24965207 2014 Associations of complement factor B and complement component 2 genotypes with subtypes of polypoidal choroidal vasculopathy.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24519512 Complement C3, C2, and factor B gene polymorphisms and age-related macular degeneration in a Greek cohort study.
24453474 2014 CFH haplotypes and ARMS2, C2, C3, and CFB alleles show association with susceptibility to age-related macular degeneration in Mexicans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
More...