Property Summary

NCBI Gene PubMed Count 75
PubMed Score 41.60
PubTator Score 34.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Non-alcoholic Fatty Liver Disease 42
Disease Target Count P-value
ovarian cancer 8520 6.7e-06
Multiple myeloma 1332 4.7e-04
lung cancer 4740 7.0e-03
colon cancer 1478 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Argentine hemorrhagic fever 10 3.018 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer -1.600 2.6e-02
lung cancer 1.900 7.0e-03
Multiple myeloma 1.292 4.7e-04
ovarian cancer 2.400 6.7e-06

Gene RIF (38)

AA Sequence

MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAV      1 - 70
VDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPET     71 - 140
LGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGV    141 - 210
GKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARA    211 - 280
RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTK    281 - 350
KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV    351 - 420
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKG    421 - 490
FQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS                                   491 - 529
//

Text Mined References (83)

PMID Year Title