Property Summary

NCBI Gene PubMed Count 69
Grant Count 5
Funding $1,332,813
PubMed Score 36.35
PubTator Score 34.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.292 0.000
colon cancer -1.600 0.026
lung cancer 1.900 0.007
ovarian cancer 2.400 0.000

Synonym

Accession P06576 A8K4X0 Q14283
Symbols ATPMB
ATPSB
HEL-S-271

Gene

Gene RIF (33)

PMID Text
26835708 Hypermethylation of ATPsyn-beta gene promoter is associated with a down-regulated mRNA expression and chemoresistance in AML patients.
26769832 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase
26526033 High mRNA levels of ATP5B are associated with glioblastoma.
26387949 PKA phosphorylates the ATPase inhibitory factor 1 and inactivates its capacity to bind and inhibit the mitochondrial H(+)-ATP synthase.
25311765 Our study suggested that positive beta2M expression or loss of ATP5B expression in tumor tissues is closely related to the metastasis, invasion, and poor-prognosis of gallbladder cancer.
24583174 No significant relationship was detected in the level of expression of the ATP2B4 and ATP5B genes in cancerous and healthy tissues of colorectal cancer patients.
24583174 ATP5B gene expressions were detected significantly higher in colorectal cancer samples.
24391795 Mitochondrial ATPsyn-beta expression and ATP synthase activity in relapsed/refractory acute myeloid leukemia patients were downregulated. This downregulated expression exhibited a positive correlation with the response to adriamycin of primary cells.
23874603 HIV-1 Tat upregulates the expression of ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide (ATP5B) in Jurkat cells
23523934 H2O2 may induce melanogenesis via the upregulation of PAH and activation of cAMP/p-CREB/MITF signaling by increasing intracellular cAMP levels through the induction of ATP5B.
More...

AA Sequence

MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAV      1 - 70
VDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPET     71 - 140
LGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGV    141 - 210
GKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARA    211 - 280
RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTK    281 - 350
KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV    351 - 420
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKG    421 - 490
FQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS                                   491 - 529
//

Text Mined References (77)

PMID Year Title
26835708 2016 Hypermethylation of CpG sites at the promoter region is associated with deregulation of mitochondrial ATPsyn-? and chemoresistance in acute myeloid leukemia.
26769832 2015 Hemoglobin - a novel ligand of hepatocyte ectopic F1-ATPase.
26526033 2016 ATP5A1 and ATP5B are highly expressed in glioblastoma tumor cells and endothelial cells of microvascular proliferation.
26387949 2015 PKA Phosphorylates the ATPase Inhibitory Factor 1 and Inactivates Its Capacity to Bind and Inhibit the Mitochondrial H(+)-ATP Synthase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25311765 2015 ATP5b and ?2-microglobulin are predictive markers for the prognosis of patients with gallbladder cancer.
24583174 2014 Investigation of the association between ATP2B4 and ATP5B genes with colorectal cancer.
24391795 2013 Deregulation of mitochondrial ATPsyn-? in acute myeloid leukemia cells and with increased drug resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...