Property Summary

NCBI Gene PubMed Count 540
Grant Count 493
R01 Count 350
Funding $38,415,873.65
PubMed Score 1710.82
PubTator Score 1804.43

Knowledge Summary

Patent (99,621)

Expression

Synonym

Accession P06493 A8K7C4 C9J497 O60764 CDK1
Symbols CDC2
CDC28A
P34CDC2

Gene

PDB

4YC6   4Y72   4YC3   5HQ0   1LC9  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (374)

PMID Text
27030108 Aurora B and CDK1 temporally regulate the binding affinity of EB2 for microtubules, thereby ensuring kinetochore microtubule dynamics, proper mitotic progression and genome stability.
26942677 CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription.
26881434 CDK1 is a synthetic lethal target for KRAS mutant tumors.
26709398 exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression
26687548 These findings indicate that NSun2-mediated mRNA methylation regulates p27 and CDK1 levels during replicative senescence.
26674376 Regulation of RepoMan-associated phosphatases by Cdk1 is essential for the timely dephosphorylation of their mitotic substrates.
26670043 These results demonstrate a mechanism...by which CDK1 boosts mitochondrial bioenergetics to meet the increased cellular fuel demand for DNA repair and cell survival under genotoxic stress conditions
26648125 FGFR1 contributes to cell proliferation in osteosarcoma MG63 cells, and FGFR1 mediated cell proliferation may be attributed to the regulation of the cell cycle regulator, CDK1.
26647806 we discovered a novel mechanism mediated by Smad4 to trigger 5-FU chemosensitivity through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
26549230 These data suggest that the dissociation of Cep169 from centrosomes is controlled by Cdk1/Cyclin B during mitosis, and that Cep169 might regulate MT dynamics of mitotic spindle.
More...

AA Sequence

MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVL      1 - 70
MQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKG     71 - 140
TIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI    141 - 210
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM    211 - 280
ALNHPYFNDLDNQIKKM                                                         281 - 297
//

Text Mined References (564)

PMID Year Title
27030108 2016 Phosphorylation of EB2 by Aurora B and CDK1 ensures mitotic progression and genome stability.
26942677 2016 CDK1-Cyclin B1 Activates RNMT, Coordinating mRNA Cap Methylation with G1 Phase Transcription.
26881434 2016 CDK1 Is a Synthetic Lethal Target for KRAS Mutant Tumours.
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26709398 2016 Amygdalin inhibits the growth of renal cell carcinoma cells in vitro.
26687548 2015 NSun2 delays replicative senescence by repressing p27 (KIP1) translation and elevating CDK1 translation.
26674376 2015 Cdk1 orders mitotic events through coordination of a chromosome-associated phosphatase switch.
26670043 2015 CDK1 Enhances Mitochondrial Bioenergetics for Radiation-Induced DNA Repair.
26648125 2016 Fibroblast growth factor receptor 1 promotes MG63 cell proliferation and is associated with increased expression of cyclin-dependent kinase 1 in osteosarcoma.
26647806 2016 Smad4 sensitizes colorectal cancer to 5-fluorouracil through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
More...