Property Summary

NCBI Gene PubMed Count 540
PubMed Score 1710.82
PubTator Score 1804.43

Knowledge Summary

Patent (99,621)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 6.73318258953181E-49
psoriasis 6685 1.53351279687063E-39
non-small cell lung cancer 2798 7.01117539744856E-35
Breast cancer 3099 5.49067222670733E-25
atypical teratoid/rhabdoid tumor 1095 1.1291685263307E-14
pediatric high grade glioma 2712 1.33046378386097E-9
group 3 medulloblastoma 2254 3.11566174820974E-9
posterior fossa group A ependymoma 1511 3.56526478859682E-9
primitive neuroectodermal tumor 3031 7.97549534647917E-8
medulloblastoma, large-cell 6234 2.44325666260547E-7
glioblastoma 5572 3.6328817389551E-7
malignant mesothelioma 3163 6.12554582030213E-7
pancreatic cancer 2300 1.93789643553275E-6
nasopharyngeal carcinoma 1056 2.15535292008802E-6
astrocytoma 1493 2.63527052481962E-6
tuberculosis and treatment for 3 months 327 4.00875363893631E-6
lung cancer 4473 4.90972231162149E-6
oligodendroglioma 2849 9.98082720642842E-6
adrenocortical carcinoma 1427 1.35661477738284E-5
Atopic dermatitis 944 3.3694769320478E-5
pilocytic astrocytoma 3086 6.82024693223924E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.25339073087424E-4
invasive ductal carcinoma 2950 1.70421682409453E-4
ulcerative colitis 2087 2.23117889185227E-4
ovarian cancer 8492 2.38034800831623E-4
lung adenocarcinoma 2714 2.60242031063119E-4
ductal carcinoma in situ 1745 5.2433228856552E-4
colon cancer 1475 6.47031749550628E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00125988788597811
primary Sjogren syndrome 789 0.0024185828272376
Endometriosis 535 0.00665278127062265
interstitial cystitis 2299 0.0262954545951014
esophageal adenocarcinoma 737 0.0300577994931908
Waldenstrons macroglobulinemia 765 0.0303971670108097
Disease Target Count Z-score Confidence
Cancer 2346 5.796 2.9

Expression

Synonym

Accession P06493 A8K7C4 C9J497 O60764 CDK1
Symbols CDC2
CDC28A
P34CDC2

Gene

PDB

4YC6   4Y72   4YC3   5HQ0   1LC9  

  Ortholog (14)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (345)

PMID Text
27030108 Aurora B and CDK1 temporally regulate the binding affinity of EB2 for microtubules, thereby ensuring kinetochore microtubule dynamics, proper mitotic progression and genome stability.
26942677 CDK1-Cyclin B1 activates RNMT, coordinating mRNA cap methylation with G1 phase transcription.
26881434 CDK1 is a synthetic lethal target for KRAS mutant tumors.
26709398 exposing renal carcinoma cells to amygdalin inhibited cell cycle progression and tumor cell growth by impairing cdk1 and cyclin B expression
26687548 These findings indicate that NSun2-mediated mRNA methylation regulates p27 and CDK1 levels during replicative senescence.
26674376 Regulation of RepoMan-associated phosphatases by Cdk1 is essential for the timely dephosphorylation of their mitotic substrates.
26670043 These results demonstrate a mechanism...by which CDK1 boosts mitochondrial bioenergetics to meet the increased cellular fuel demand for DNA repair and cell survival under genotoxic stress conditions
26648125 FGFR1 contributes to cell proliferation in osteosarcoma MG63 cells, and FGFR1 mediated cell proliferation may be attributed to the regulation of the cell cycle regulator, CDK1.
26647806 we discovered a novel mechanism mediated by Smad4 to trigger 5-FU chemosensitivity through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
26549230 These data suggest that the dissociation of Cep169 from centrosomes is controlled by Cdk1/Cyclin B during mitosis, and that Cep169 might regulate MT dynamics of mitotic spindle.
More...

AA Sequence

MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVL      1 - 70
MQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKG     71 - 140
TIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI    141 - 210
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM    211 - 280
ALNHPYFNDLDNQIKKM                                                         281 - 297
//

Text Mined References (564)

PMID Year Title
27030108 2016 Phosphorylation of EB2 by Aurora B and CDK1 ensures mitotic progression and genome stability.
26942677 2016 CDK1-Cyclin B1 Activates RNMT, Coordinating mRNA Cap Methylation with G1 Phase Transcription.
26881434 2016 CDK1 Is a Synthetic Lethal Target for KRAS Mutant Tumours.
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26709398 2016 Amygdalin inhibits the growth of renal cell carcinoma cells in vitro.
26687548 2015 NSun2 delays replicative senescence by repressing p27 (KIP1) translation and elevating CDK1 translation.
26674376 2015 Cdk1 orders mitotic events through coordination of a chromosome-associated phosphatase switch.
26670043 2015 CDK1 Enhances Mitochondrial Bioenergetics for Radiation-Induced DNA Repair.
26648125 2016 Fibroblast growth factor receptor 1 promotes MG63 cell proliferation and is associated with increased expression of cyclin-dependent kinase 1 in osteosarcoma.
26647806 2016 Smad4 sensitizes colorectal cancer to 5-fluorouracil through cell cycle arrest by inhibiting the PI3K/Akt/CDC2/survivin cascade.
More...