Property Summary

NCBI Gene PubMed Count 85
PubMed Score 279.53
PubTator Score 88.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (44)

AA Sequence

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEG      1 - 70
DGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD                                  71 - 111
//

Text Mined References (99)

PMID Year Title