Property Summary

NCBI Gene PubMed Count 83
Grant Count 9
R01 Count 5
Funding $1,082,268.06
PubMed Score 270.69
PubTator Score 88.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
26348351 PTMA is a potential novel therapeutic target for type 2 diabetes
25582950 Data suggest that KEAP1 (kelch-like ECH-associated protein 1) mutations (as those observed in lung cancer patients) affect conformation/folding/stability of KEAP1 and binding affinity for ligands PTMA and NRF2 (nuclear factor erythroid 2-like 2).
25404520 Knockdown of prothymosin alpha by siRNA enhances HIV-1 replication in macrophages through the downregulation of type I interferon
25197357 disease-free survival and overall survival rates were significantly lower among colorectal cancer patients with PTMA- and TP53-positive tumors
24733561 prothymosin-alpha expression is a determinant of disease progression in superficial bladder cancer
23859021 phosphorylation of ProTalpha is required for its antiapoptotic activity, but it does not affect its nuclear import
23857453 PTalpha offers cardioprotection against ischemic injury by an Akt-dependent mechanism.
23695700 These results demonstrate the clinical relevance of prothymosin alpha in regulating acetylation events during the pathogenesis of emphysema.
23359453 Western blot analysis of protein extracts from sperm head fractions confirms that the peptide is specifically associated with the inner acrosomal membrane fraction.
23318954 ProTalpha is crucial for the interaction with the Kelch domain, while the flanking residues play relatively minor roles in the affinity of binding.
More...

AA Sequence

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEG      1 - 70
DGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD                                  71 - 111
//

Text Mined References (96)

PMID Year Title
26348351 2015 Prothymosin-? Overexpression Contributes to the Development of Insulin Resistance.
25582950 2015 Molecular effects of cancer-associated somatic mutations on the structural and target recognition properties of Keap1.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25197357 2014 Increased expression of prothymosin-?, independently or combined with TP53, correlates with poor prognosis in colorectal cancer.
24733561 2014 Loss of nuclear prothymosin-? expression is associated with disease progression in human superficial bladder cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23859021 2013 The influence of phosphorylation of prothymosin ? on its nuclear import and antiapoptotic activity.
23857453 2013 Prothymosin alpha protects cardiomyocytes against ischemia-induced apoptosis via preservation of Akt activation.
23695700 2013 Prothymosin ? overexpression contributes to the development of pulmonary emphysema.
More...