Property Summary

NCBI Gene PubMed Count 601
Grant Count 1,059
R01 Count 514
Funding $132,497,799.41
PubMed Score 7682.56
PubTator Score 5388.46

Knowledge Summary

Patent (94,080)

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Breast cancer 3,094 8.257 4.0
Endometrial cancer 25 6.198 3.1
Carcinoma 2,147 5.935 3.0
ductal carcinoma in situ 1,745 5.761 2.9
Endometriosis 535 5.494 2.7
Leiomyoma 25 5.063 2.5
Uterine fibroid 29 4.711 2.4
Meningioma 26 4.481 2.2
ovarian cancer 8,484 4.462 2.2
Myoma 12 4.313 2.2
Progressive relapsing multiple sclerosis 18 4.267 2.1
Breast fibroadenoma 8 4.253 2.1
Breast disease 8 4.248 2.1
Infertility 163 3.957 2.0
Apocrine adenocarcinoma 2 3.864 1.9
Leiomyosarcoma 19 3.742 1.9
Amenorrhea 60 3.528 1.8
Lobular neoplasia 15 3.502 1.8
Lymphangioleiomyomatosis 17 3.403 1.7
Carcinosarcoma 6 3.352 1.7
Angiomyolipoma 17 3.144 1.6
Vulvar syringoma 1 3.091 1.5
Acne vulgaris 16
Adenocarcinoma 115
Amenorrhea Secondary to Ovarian Dysfunct... 8 
Animal Mammary Neoplasms 136
Anorexia from HIV 5
Atrophic vaginitis 14
Atrophic vulva 6
Cachexia due to HIV 1
Contraception 15
Corpus Luteum Insufficiency Syndrome 8
Dysfunctional uterine bleeding 9
Endometrial Hyperplasia Prevention 9
Endometrial Neoplasms 50
Endometrial carcinoma 18
Female hypogonadism syndrome 7
Fibrocystic breast changes 3
Hereditary Angioedema Prevention 3
Hormone receptor positive malignant neop... 10 
Infertility Secondary to Progesterone De... 8 
Mammary Neoplasms 410
Mammary Neoplasms, Experimental 150
Menopausal flushing 17
Menorrhagia 8
Mesothelioma 40
Nutritional deficiency associated with A... 1 
Postcoital contraception 2
Postmenopausal osteoporosis 19
Pregnancy with abortive outcome 12
Premenstrual dysphoric disorder 8
Prevention of Premature Labor 9
Primary ovarian failure 5
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 9
Uterine leiomyoma 1
colon cancer 1,475
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
posterior fossa group B ependymoma 1,530

Expression

Synonym

Accession P06401 A7LQ08 A7X8B0 B4E3T0 Q8TDS3 Q9UPF7 PR
Symbols PR
NR3C3

Gene

PGR

PDB

4OAR   1A28   1E3K   1SQN   1SR7   1ZUC   2C7A   2OVH   2OVM   2W8Y   3D90   3G8O   3HQ5   3KBA   3ZR7   3ZRA   3ZRB   4A2J   4APU   5CC0  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (591)

PMID Text
27069179 Neural Analyses Validate and Emphasize the Role of Progesterone Receptor in Breast Cancer Progression and Prognosis
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26892043 Data demonstrated the significance of PR extranuclear signaling through PPD interactions in EGFR-mediated proliferation and signaling in NSCLC.
26829108 the MapQuanttrade mark assay, based on mRNA expression assay, provides an objective and quantitative assessment of Estrogen receptor, Progesterone receptor and HER2 status in invasive breast cancer.
26820652 TargetPrint ER had a positive agreement of 98 %, and a negative agreement of 95 % with central pathology. Corresponding figures for PgR were 85 and 94 % and for HER-2 72 and 99 %. Agreement of mRNA versus central protein was not different when the same or a different portion of the tumor tissue was analyzed or when DCIS and/or normal tissue was included in the sample subjected to mRNA assays
26579819 Analysis of patients with ER-/PgR+/HER2- breast cancers showed that this subtype exhibited an aggressive behavior compared to triple negative breast cancers.
26577046 Study indicate that PR-B isoform is the dominant driver of cellular senescence in ovarian cancer cells and reveal that dephosphorylated FOXO1 confers potent PR-B-like transcriptional activity to PR-A and is required for its phosphorylation on Ser294 and transactivation of PR-B.
26550991 Estrogen receptor, progesterone receptor or human epidermal growth factor receptor 2 samples with high-methylation risk score had the worst 5-year survival rate and overall survival time.
26517007 findings suggest that human labour may develop as a consequence of a decline in mPR(alpha+) Treg cells, which reduces progesterone anti-inflammatory action through Treg cells.
26458823 Rs11571215 in PGR (progesterone receptor) was the SNP most strongly associated with ER- disease.
More...

AA Sequence

MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS      1 - 70
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSW     71 - 140
CLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPV    141 - 210
KPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRV    211 - 280
ALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASS    281 - 350
TPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG    351 - 420
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLL    421 - 490
PRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFE    491 - 560
SLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQA    561 - 630
GMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY    631 - 700
AGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKH    701 - 770
VSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ    771 - 840
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMS    841 - 910
EVIAAQLPKILAGMVKPLLFHKK                                                   911 - 933
//

Text Mined References (614)

PMID Year Title
27069179 2016 Neural Analyses Validate and Emphasize the Role of Progesterone Receptor in Breast Cancer Progression and Prognosis.
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26892043 2016 Progesterone receptor (PR) polyproline domain (PPD) mediates inhibition of epidermal growth factor receptor (EGFR) signaling in non-small cell lung cancer cells.
26829108 2016 Estrogen-Receptor, Progesterone-Receptor and HER2 Status Determination in Invasive Breast Cancer. Concordance between Immuno-Histochemistry and MapQuant™ Microarray Based Assay.
26820652 2016 Discordant assessment of tumor biomarkers by histopathological and molecular assays in the EORTC randomized controlled 10041/BIG 03-04 MINDACT trial breast cancer : Intratumoral heterogeneity and DCIS or normal tissue components are unlikely to be the cause of discordance.
26579819 2015 Prognostic Significance of Single Progesterone Receptor Positivity: A Comparison Study of Estrogen Receptor Negative/Progesterone Receptor Positive/Her2 Negative Primary Breast Cancer With Triple Negative Breast Cancer.
26577046 2016 Active FOXO1 Is a Key Determinant of Isoform-Specific Progesterone Receptor Transactivation and Senescence Programming.
26550991 2015 DNA Methylation Patterns Can Estimate Nonequivalent Outcomes of Breast Cancer with the Same Receptor Subtypes.
26517007 2016 Can membrane progesterone receptor ? on T regulatory cells explain the ensuing human labour?
26458823 2015 Hormone-related pathways and risk of breast cancer subtypes in African American women.
More...