Property Summary

Ligand Count 630
NCBI Gene PubMed Count 636
PubMed Score 7951.25
PubTator Score 5388.46

Knowledge Summary

Patent (94,080)

TINX Plot

  Disease (5)

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -2.000 2.8e-02
ovarian cancer -4.200 2.0e-08
colon cancer -1.100 2.8e-03
interstitial cystitis -1.700 1.1e-03
intraductal papillary-mucinous adenoma (... -1.100 8.1e-04
intraductal papillary-mucinous carcinoma... -1.300 4.1e-04
intraductal papillary-mucinous neoplasm ... -1.100 6.8e-03
invasive ductal carcinoma -2.300 7.4e-03
lung cancer -1.500 8.2e-04
posterior fossa group B ependymoma 1.300 2.2e-04

Gene RIF (625)

AA Sequence

MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS      1 - 70
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSW     71 - 140
CLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPV    141 - 210
KPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRV    211 - 280
ALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASS    281 - 350
TPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG    351 - 420
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLL    421 - 490
PRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFE    491 - 560
SLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQA    561 - 630
GMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY    631 - 700
AGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKH    701 - 770
VSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ    771 - 840
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMS    841 - 910
EVIAAQLPKILAGMVKPLLFHKK                                                   911 - 933
//

Text Mined References (656)

PMID Year Title