Property Summary

NCBI Gene PubMed Count 846
Grant Count 766
R01 Count 481
Funding $86,960,585.38
PubMed Score 1092.14
PubTator Score 3208.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 1.371 0.001
Rheumatoid Arthritis 1.100 0.046
malignant mesothelioma 1.100 0.002
astrocytic glioma 1.100 0.006
ependymoma 1.600 0.010
oligodendroglioma 1.300 0.006
glioblastoma 1.600 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma 1.700 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.200 0.000
juvenile dermatomyositis 1.053 0.000
acute quadriplegic myopathy 1.068 0.000
primary Sjogren syndrome 1.100 0.002
dermatomyositis 1.500 0.003

Synonym

Accession P06400 A8K5E3 P78499 Q5VW46 Q8IZL4
Symbols RB
pRb
OSRC
pp110
p105-Rb
PPP1R130

Gene

RB1

PANTHER Protein Class (1)

PDB

4CRI   3N5U   1H25   2AZE   1N4M   1AD6   1GH6   1GUX   1O9K   1PJM   2QDJ   2R7G   3POM   4ELJ   4ELL  

Gene RIF (615)

PMID Text
27012093 these results demonstrate complex links between different signaling cascades in stressed hMESC, implicating ERK, p38 and JNK in regulation of the premature senescence via p53/p21/Rb pathway.
26928463 AR activity was inversely associated with cell proliferation, whereas the expression of Fa complex genes was correlated with elevated cell cycle progression, expression of the E2F transcription factor 1 (E2F1) and loss of RB1.
26925970 The maternally inherited c.1981C>T/p.Arg661Trp RB1 allele retains sufficient tumor suppressor activity to prevent retinoblastoma development.
26810492 RB proteins stabilize interactions of the NuRD corepressor complex within the L1 promoter to effect L1 silencing
26783196 efficacy of irinotecan on colorectal cancer could be predicted by phosphorylated RB expression, which is known to be crucial for G1/S progression and cell proliferation
26718407 These data suggest that CBX8 modulates SIPS through the RB-E2F1 pathway in CML cells and provide important insight into its application in CML treatment.
26713361 These data collectively suggest a novel mechanism involving CSLC-specific targeting by evodiamine and its possible use to the therapy of breast cancer.
26711265 The N terminus of the Retinoblastoma Protein (RB) inhibits DNA replication via interactions with Mcm7.
26708419 This inhibition was accompanied by a strong decrease in G1 cyclins (particularly in cyclin D1) and retinoblastoma protein (Rb) phosphorylation
26677227 Ras induces the formation of a complex between NORE1A and the phosphatase PP1A, promoting the activation of the Rb tumor suppressor by dephosphorylation
More...

AA Sequence

MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHV      1 - 70
RERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDT     71 - 140
STKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMED    141 - 210
DLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKE    211 - 280
HECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDS    281 - 350
FETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK    351 - 420
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACA    421 - 490
LEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMES    491 - 560
LAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAET    561 - 630
QATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHL    631 - 700
DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQ    701 - 770
YASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG    771 - 840
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTR    841 - 910
MQKQKMNDSMDTSNKEEK                                                        911 - 928
//

Text Mined References (869)

PMID Year Title
27012093 2015 [RELATIONSHIP BETWEEN p53/p21/Rb AND MAPK SIGNALING PATHWAYS IN HUMAN ENDOMETRIUM-DERIVED STEM CELLS UNDER OXIDATIVE STRESS].
26928463 2016 Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer.
26925970 2016 A Parent-of-Origin Effect Impacts the Phenotype in Low Penetrance Retinoblastoma Families Segregating the c.1981C>T/p.Arg661Trp Mutation of RB1.
26810492 2016 LINE-1 silencing by retinoblastoma proteins is effected through the nucleosomal and remodeling deacetylase multiprotein complex.
26783196 2016 Phosphorylated retinoblastoma protein is a potential predictive marker of irinotecan efficacy for colorectal cancer.
26718407 2016 CBX8 antagonizes the effect of Sirtinol on premature senescence through the AKT-RB-E2F1 pathway in K562 leukemia cells.
26713361 2016 Evodiamine selectively targets cancer stem-like cells through the p53-p21-Rb pathway.
26711265 2015 The N Terminus of the Retinoblastoma Protein Inhibits DNA Replication via a Bipartite Mechanism Disrupted in Partially Penetrant Retinoblastomas.
26708419 2016 The anti-diabetic drug metformin inhibits pancreatic cancer cell proliferation in vitro and in vivo: Study of the microRNAs associated with the antitumor effect of metformin.
26677227 2016 Ras Regulates Rb via NORE1A.
More...