Property Summary

NCBI Gene PubMed Count 208
PubMed Score 1340.36
PubTator Score 909.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.9
Disease Target Count Z-score Confidence
Finnish type amyloidosis 1 0.0 5.0
Disease Target Count Z-score Confidence
Amyloidosis 67 6.215 3.1
Disease Target Count
Amyloidosis, Finnish Type 1

Expression

  Differential Expression (31)

Disease log2 FC p
active ulcerative colitis 1.478 4.2e-02
astrocytoma 1.700 7.1e-03
Astrocytoma, Pilocytic 1.400 2.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.032 1.5e-02
breast carcinoma -1.900 4.9e-06
colon cancer -1.900 1.9e-05
COPD -1.400 9.7e-03
Duchenne muscular dystrophy 1.229 1.1e-06
ductal carcinoma in situ -2.100 3.1e-04
Endometriosis -1.036 4.1e-02
ependymoma 1.700 5.3e-08
esophageal adenocarcinoma -1.500 1.8e-02
fibroadenoma -1.600 1.7e-03
Gaucher disease type 1 1.100 6.1e-03
group 4 medulloblastoma -1.400 6.0e-03
inflammatory breast cancer -1.100 6.0e-03
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous adenoma (... 1.800 1.0e-03
intraductal papillary-mucinous carcinoma... 2.300 3.8e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.8e-02
invasive ductal carcinoma -1.209 1.0e-04
lung cancer -2.200 6.9e-06
malignant mesothelioma -2.400 1.4e-07
osteosarcoma 1.322 3.3e-02
ovarian cancer -1.100 6.8e-03
pancreatic cancer 1.500 2.8e-03
permanent atrial fibrillation -1.100 2.3e-04
primary pancreatic ductal adenocarcinoma 1.600 2.1e-03
psoriasis 1.100 2.1e-03
tuberculosis 1.700 5.2e-07
X-linked cerebral adrenoleukodystrophy -1.300 4.5e-02

Gene RIF (137)

AA Sequence

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQI      1 - 70
WRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLN     71 - 140
GRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESF    141 - 210
NNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPAL    211 - 280
PAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA    281 - 350
NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV    351 - 420
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQII    421 - 490
YNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAP    491 - 560
ASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPV    561 - 630
QVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML    631 - 700
LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSV    701 - 770
DPLDRAMAELAA                                                              771 - 782
//

Text Mined References (215)

PMID Year Title