Property Summary

NCBI Gene PubMed Count 180
Grant Count 272
R01 Count 178
Funding $34,342,894.08
PubMed Score 1282.13
PubTator Score 909.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P06396 A2A418 A8MUD1 A8MYN7 B7Z373 B7Z5V1 F5H1A8 Q5T0I2 Q8WVV7
Symbols ADF
AGEL

Gene

GSN

PDB

4PKG   4PKH   4PKI   4Z94   3TU5   1T44   2FF3   1C0F   1C0G   1D4X   1DEJ   1EQY   1ESV   1H1V   1KCQ   1MDU   1NLV   1NM1   1NMD   1P8X   1P8Z   1SOL   1YAG   1YVN   2FF6   2FH1   2FH2   2FH3   2FH4   3A5L   3A5M   3A5N   3A5O   3CI5   3CIP   3CJB   3CJC   3FFK   3FFN   4S10  

Gene RIF (120)

PMID Text
26878213 novel roles for actin-depolymerizing factor and cofilin-1 in regulating the remodeling and permeability of epithelial junctions
26823700 GSN overexpression suppresses apoptosis while down-regulated GSN promotes apoptosis in hepatocellular carcinoma.
26666486 Fragmented gelsolins may be associated with the pathogenesis of fibrosis in RA-ILD.
26598132 gelsolin interacts with particular components of the three cytoskeleton systems and is a constituent of midbodies
26482896 TGF-beta1 induced epigenetic modification of GSN could alter the EMT process in breast cancer cells.
26408687 Results show that high gelsolin levels are associated with better prognosis in ER+HER2- breast cancer and a reduction in tumor cell migration.
26404905 Serum-expressed apolipoprotein B-100 protein, C9 Complement, and gelsolin can be used for differential diagnosis of Barrertts esophagus and adenocarcinoma of esophagus.
26398833 The overexpression of GSN may inhibit the proliferation, adhesion ability and invasion of 786-0 clear cell renal cell carcinoma cell line.
26149653 Gelsolin expression promoted tumor-associated phenotypes by facilitating proliferative and invasive capacities of hepatocellular carcinoma(HCC) cells, which might serve as a potential therapeutic target for HCC treatment.
25600697 We designed and synthesized siRNA against various exons in the gelsolin gene (GSN)..our finds reveal siRNA, which is derived from target gene exon, can form the complex with H3 histone to be involved in the regulation of gene expression
More...

AA Sequence

MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQI      1 - 70
WRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLN     71 - 140
GRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESF    141 - 210
NNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPAL    211 - 280
PAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQA    281 - 350
NTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERV    351 - 420
PFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQII    421 - 490
YNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAP    491 - 560
ASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPV    561 - 630
QVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVML    631 - 700
LDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSV    701 - 770
DPLDRAMAELAA                                                              771 - 782
//

Text Mined References (187)

PMID Year Title
26878213 2016 Actin-Depolymerizing Factor and Cofilin-1 Have Unique and Overlapping Functions in Regulating Intestinal Epithelial Junctions and Mucosal Inflammation.
26823700 2015 Cellular transcriptomics: gelsolin negatively regulates the expression of apoptosis-associated genes and inhibits apoptosis in hepatocarcinoma cells.
26666486 2016 Fragmented gelsolins are increased in rheumatoid arthritis-associated interstitial lung disease with usual interstitial pneumonia pattern.
26598132 2016 Gelsolin interacts with LamR, hnRNP U, nestin, Arp3 and ?-tubulin in human melanoma cells as revealed by immunoprecipitation and mass spectrometry.
26482896 2015 Involvement of gelsolin in TGF-beta 1 induced epithelial to mesenchymal transition in breast cancer cells.
26408687 2015 Gelsolin Is Associated with Longer Metastasis-free Survival and Reduced Cell Migration in Estrogen Receptor-positive Breast Cancer.
26404905 2015 Serum Glycoprotein Biomarker Discovery and Qualification Pipeline Reveals Novel Diagnostic Biomarker Candidates for Esophageal Adenocarcinoma.
26398833 2015 Gelsolin inhibits the proliferation and invasion of the 786-0 clear cell renal cell carcinoma cell line in vitro.
26149653 2015 Role of gelsolin in cell proliferation and invasion of human hepatocellular carcinoma cells.
25600697 2015 siRNA induces gelsolin gene transcription activation in human esophageal cancer cell.
More...