Property Summary

NCBI Gene PubMed Count 43
PubMed Score 71.70
PubTator Score 61.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Hepatitis B, Chronic 15
Disease Target Count P-value
lung carcinoma 2844 7.07089255377688E-26
non-small cell lung cancer 2798 2.0968733388764E-10
pilocytic astrocytoma 3086 2.6590808022856E-6
ulcerative colitis 2087 1.89685317019831E-4
osteosarcoma 7933 2.81680454797489E-4
interstitial cystitis 2299 2.96494767802852E-4
posterior fossa group A ependymoma 1511 3.30270348167533E-4
invasive ductal carcinoma 2950 3.49928086780137E-4
active Crohn's disease 918 4.29128716817281E-4
tuberculosis and treatment for 3 months 327 5.81995913007817E-4
lung cancer 4473 6.22965124651007E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.82686651057492E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00178307563850437
breast carcinoma 1614 0.00178393597032324
primary Sjogren syndrome 789 0.00255148236677167
glioblastoma 5572 0.00452844488268385
lung adenocarcinoma 2714 0.00562521211965871
cutaneous lupus erythematosus 1056 0.00663495132302637
adrenocortical carcinoma 1427 0.00730608678934106
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00779553000661394
adult high grade glioma 2148 0.0109105412019755
primary pancreatic ductal adenocarcinoma 1271 0.0184008941592061
subependymal giant cell astrocytoma 2287 0.020057095502606
Disease Target Count Z-score Confidence
Alopecia universalis 10 3.844 1.9
Keshan disease 14 3.032 1.5

Expression

Synonym

Accession P06340 Q58HU0 Q58HU1 Q5STC7 Q9TQC6 Q9TQC7 Q9TQC8 Q9TQC9 Q9TQD0 Q9TQD1 Q9TQD2 Q9TQD3
Symbols HLADZ
HLA-DNA
HLA-DZA

Gene

PDB

4I0P  

  Ortholog (4)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid

Gene RIF (60)

PMID Text
26610428 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
25758996 significant association was found between white wine liking and rs9276975:C>T polymorphism in the HLA-DOA gene.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24530695 HLA-DO regulates surface presentation of human leukocyte antigen class II-restricted antigens on B cell malignancies.
24384427 HLA-DOA, HLA-DRA, and HLA-DQA1 associated with spontaneous autoimmunity
23222639 results show that HLA-DO inhibits HLA-DM function by acting as a substrate mimic, and the findings also limit the possible functional roles for HLA-DO in antigen presentation
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22733780 analysis of the HLA-DO/HLA-DM complex by FRET and mutagenesis
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWR      1 - 70
LPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFP     71 - 140
PVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPI    141 - 210
PPPDAMETLVCALGLAIGLVGFLVGTVLIIMGTYVSSVPR                                  211 - 250
//

Text Mined References (45)

PMID Year Title
26610428 2015 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
25758996 2015 Genome-wide association analysis on five isolated populations identifies variants of the HLA-DOA gene associated with white wine liking.
25416956 2014 A proteome-scale map of the human interactome network.
24530695 2014 Human leukocyte antigen-DO regulates surface presentation of human leukocyte antigen class II-restricted antigens on B cell malignancies.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23222639 2013 HLA-DO acts as a substrate mimic to inhibit HLA-DM by a competitive mechanism.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
More...