Property Summary

NCBI Gene PubMed Count 43
Grant Count 10
Funding $2,170,657
PubMed Score 71.70
PubTator Score 61.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (64)

PMID Text
26610428 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
25758996 significant association was found between white wine liking and rs9276975:C>T polymorphism in the HLA-DOA gene.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24530695 HLA-DO regulates surface presentation of human leukocyte antigen class II-restricted antigens on B cell malignancies.
24384427 HLA-DOA, HLA-DRA, and HLA-DQA1 associated with spontaneous autoimmunity
23222639 results show that HLA-DO inhibits HLA-DM function by acting as a substrate mimic, and the findings also limit the possible functional roles for HLA-DO in antigen presentation
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22733780 analysis of the HLA-DO/HLA-DM complex by FRET and mutagenesis
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
More...

AA Sequence

MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWR      1 - 70
LPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFP     71 - 140
PVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPI    141 - 210
PPPDAMETLVCALGLAIGLVGFLVGTVLIIMGTYVSSVPR                                  211 - 250
//

Text Mined References (45)

PMID Year Title
26610428 2015 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
25758996 2015 Genome-wide association analysis on five isolated populations identifies variants of the HLA-DOA gene associated with white wine liking.
25416956 2014 A proteome-scale map of the human interactome network.
24530695 2014 Human leukocyte antigen-DO regulates surface presentation of human leukocyte antigen class II-restricted antigens on B cell malignancies.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23222639 2013 HLA-DO acts as a substrate mimic to inhibit HLA-DM by a competitive mechanism.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
More...