Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma -1.299 0.000
cutaneous lupus erythematosus 1.900 0.027
osteosarcoma -4.696 0.000
chronic lymphosyte leukemia -1.500 0.000
periodontitis 2.200 0.000
tuberculosis 1.100 0.004
non-small cell lung cancer 1.533 0.000
lung cancer -1.900 0.000
interstitial cystitis 3.100 0.002
ulcerative colitis 3.500 0.000
chronic rhinosinusitis 1.320 0.023

Synonym

Accession P06331 A0A0A0MS12 A0A0G2JP38
Symbols VH
IGHV434

Gene

Gene RIF (1)

PMID Text
20801898 Data demonstrate distinct gene expression profiles among patients with stereotyped IGHV4-34 B-cell receptors.

AA Sequence

MDLLHKNMKHLWFFLLLVAAPRWVLSQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKG      1 - 70
LEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR                      71 - 123
//

Text Mined References (10)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20801898 2010 Distinct gene expression profiles in subsets of chronic lymphocytic leukemia expressing stereotyped IGHV4-34 B-cell receptors.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11340299 2001 Nomenclature of the human immunoglobulin heavy (IGH) genes.
9841928 1998 The complete nucleotide sequence of the human immunoglobulin heavy chain variable region locus.
9419211 1998 Somatic hypermutation introduces insertions and deletions into immunoglobulin V genes.
3922855 1985 A cloned human immunoglobulin heavy chain gene with a novel direct-repeat sequence in 5' flanking region.
3133445 1988 Immunoglobulin VH genes are transcribed by T cells in association with a new 5' exon.