Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
chronic lymphosyte leukemia -1.500 1.9e-09
chronic rhinosinusitis 1.320 2.3e-02
cutaneous lupus erythematosus 1.900 2.7e-02
interstitial cystitis 2.300 2.4e-02
lung cancer -1.900 1.5e-05
Multiple myeloma -1.299 1.5e-04
non-small cell lung cancer 1.533 3.2e-07
osteosarcoma -4.696 1.4e-11
periodontitis 2.200 6.8e-31
tuberculosis 1.100 3.9e-03
ulcerative colitis 3.500 2.5e-05

Gene RIF (1)

AA Sequence

MDLLHKNMKHLWFFLLLVAAPRWVLSQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQPPGKG      1 - 70
LEWIGEINHSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR                      71 - 123
//

Text Mined References (11)

PMID Year Title