Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung carcinoma 317 3.1e-11
lung adenocarcinoma 2716 1.8e-10

AA Sequence

MGSQVHLLSFLLLWISDTRAETTLTQSPAFMSATPGDKVNISCKASQDIDDDMNWYQQKPGEAAIFIIQE      1 - 70
ATTLVPGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQHDNFP                              71 - 115
//

Text Mined References (9)

PMID Year Title