Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession P06315
Symbols B2
IGKV52

Gene

AA Sequence

MGSQVHLLSFLLLWISDTRAETTLTQSPAFMSATPGDKVNISCKASQDIDDDMNWYQQKPGEAAIFIIQE      1 - 70
ATTLVPGIPPRFSGSGYGTDFTLTINNIESEDAAYYFCLQHDNFP                              71 - 115
//

Text Mined References (8)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17576170 2007 Immunoglobulin somatic hypermutation.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
3925437 1985 Aberrant recombination events in B cell lines derived from a kappa-deficient human.