Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P06312 P01625 P06313 P06314 P83593
Symbols B3
IGKV41

Gene

PDB

1DH6   1EEQ   1EEU   1EFQ   1EK3   1LVE   1QAC   2LVE   3LVE   4LVE   5LVE  

AA Sequence

MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPP      1 - 70
KLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTP                        71 - 121
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
9588180 1998 Extended analysis of AL-amyloid protein from abdominal wall subcutaneous fat biopsy: kappa IV immunoglobulin light chain.
2997713 1985 Detection of a unique human V kappa IV germline gene by a cloned cDNA probe.
More...