Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P06310 A0A075B6S3
Symbols A17
IGKV230

Gene

AA Sequence

MRLPAQLLGLLMLWVPGSSGDVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPR      1 - 70
RLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWP                         71 - 120
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17576170 2007 Immunoglobulin somatic hypermutation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11549845 2001 Nomenclature of the human immunoglobulin kappa (IGK) genes.
2997711 1985 Human immunoglobulin kappa light chain genes of subgroups II and III.
More...