Property Summary

NCBI Gene PubMed Count 114
Grant Count 882
R01 Count 556
Funding $98,109,447.24
PubMed Score 7574.80
PubTator Score 2246.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Pancreatitis 97 6.679 3.3
Gallbladder disease 3 6.453 3.2
Cholecystitis 8 5.915 3.0
Panic disorder 55 5.388 2.7
Pain agnosia 99 5.369 2.7
Obesity 616 5.158 2.6
Irritable bowel syndrome 59 4.928 2.5
Steatorrhea 20 4.496 2.2
Exocrine pancreatic insufficiency 21 4.492 2.2
Dyspepsia 34 4.467 2.2
Eating disorder 24 4.424 2.2
Schizophrenia 501 4.266 2.1
Constipation 43 4.243 2.1
Duodenal ulcer 20 4.126 2.1
Duodenogastric reflux 8 4.108 2.1
Cancer 2,346 4.031 2.0
diabetes mellitus 1,663 3.974 2.0
Morphine dependence 19 3.892 1.9
Cholestasis 93 3.591 1.8
Diarrhea 155 3.522 1.8
Gastroparesis 20 3.426 1.7
Bile reflux 8 3.419 1.7
Gastroesophageal reflux disease 37 3.401 1.7
Postcholecystectomy syndrome 3 3.331 1.7
Withdrawal disorder 19 3.277 1.6
Autonomic neuropathy 21 3.267 1.6
Gastritis 44 3.173 1.6
cystic fibrosis 1,665 3.083 1.5
Substance abuse 55 3.063 1.5
Epilepsy 346 3.033 1.5
Acquired metabolic disease 267 2.0
Anorexia 15
Biliary calculi 4
Catalepsy 15
Down syndrome 548
Dyskinesia, Drug-Induced 15
Gastric ulcer 34
Gastrointestinal Diseases 12
Hyperactive behavior 31
Inflammation 109
Liver diseases 66
Neurotoxicity Syndromes 26
Pick disease 1,893
Seizures 95
Unconscious State 2
adult high grade glioma 2,148
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
ependymoma 2,514
glioblastoma 5,572
intraductal papillary-mucinous neoplasm ... 3,289 
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -4.200 0.001
ependymoma -5.500 0.001
oligodendroglioma -3.700 0.000
glioblastoma -4.800 0.000
medulloblastoma -4.900 0.000
atypical teratoid / rhabdoid tumor -3.200 0.020
medulloblastoma, large-cell -5.400 0.002
primitive neuroectodermal tumor -4.900 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.006
cystic fibrosis 1.100 0.003
adult high grade glioma -3.600 0.008
pilocytic astrocytoma -4.400 0.000
Pick disease -1.400 0.032
pituitary cancer -1.300 0.006
Down syndrome -1.500 0.005

Synonym

Accession P06307 CCK
Symbols

Gene

CCK

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (86)

PMID Text
26762368 Data suggest that endocrine responses differ between jejunal and gastric enteral feeding, with higher peak plasma CCK (cholecystokinin), PYY (peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding.
26454231 These data offer preliminary evidence supporting an association between the rs1799923 polymorphism in the CCK gene and PTSD
25984632 active GLP-1 produced in the islet stimulates cholecystokinin production and secretion in a paracrine manner via cyclic AMP and CREB.
25627687 Cardiac expression of pro-cholecystokinin is cell-specific, which differentiates the expression from that of intestinal endocrine cells and cerebral neurons. Plasma Pro-CCK is a prognostic marker in patients with stable heart failure.
24914377 CCK binding modulates the contractile function of the lower esophageal sphincter through differential binding to the CCK-A receptor on the sling and clasp fibers
24692543 CCK enhances cholesterol absorption by activation of a pathway involving CCK1R/CCK2R, Gbetagamma, PI3K, Akt, Rab11a, and NPC1L.
24252886 Results suggest excessive local release of CCK in response to duodenal lipid in functional dyspepsia.
24177032 This review will summarize what is known regarding CCK, its receptors, and pancreatic--{REVIEW}
24001751 We aimed to determine whether fasting or meal-stimulated ghrelin, PYY, CCK, and satiety responses are different between lean PCOS patients and healthy women.
23975326 Data suggest that up-regulation of plasma CCK levels is 50% higher following breakfast of meal replacement beverage containing fat emulsion of rapeseed oil with droplet size of 0.1 um (versus 0.3 um); satiety response and food intake are unaffected.
More...

AA Sequence

MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQAR      1 - 70
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS                              71 - 115
//

Text Mined References (114)

PMID Year Title
26762368 2016 Jejunal feeding is followed by a greater rise in plasma cholecystokinin, peptide YY, glucagon-like peptide 1, and glucagon-like peptide 2 concentrations compared with gastric feeding in vivo in humans: a randomized trial.
26454231 2015 Exploring the association between a cholecystokinin promoter polymorphism (rs1799923) and posttraumatic stress disorder in combat veterans.
25984632 2015 Glucagon-Like Peptide-1 Regulates Cholecystokinin Production in ?-Cells to Protect From Apoptosis.
25627687 2015 Cardiomyocyte expression and cell-specific processing of procholecystokinin.
24914377 2014 Investigation of cholecystokinin receptors in the human lower esophageal sphincter.
24692543 2014 Up-regulation of cholesterol absorption is a mechanism for cholecystokinin-induced hypercholesterolemia.
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
24252886 2014 Functional dyspepsia patients have lower mucosal cholecystokinin concentrations in response to duodenal lipid.
24177032 2014 Cholecystokinin and pancreatic cancer: the chicken or the egg?
24001751 2013 Basal and meal-stimulated ghrelin, PYY, CCK levels and satiety in lean women with polycystic ovary syndrome: effect of low-dose oral contraceptive.
More...