Property Summary

NCBI Gene PubMed Count 119
PubMed Score 7612.12
PubTator Score 2246.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.4

Expression

  Differential Expression (15)

Disease log2 FC p
cystic fibrosis 1.100 3.2e-03
adult high grade glioma -3.600 8.0e-03
astrocytic glioma -3.500 5.8e-03
Astrocytoma, Pilocytic -4.400 3.6e-06
atypical teratoid / rhabdoid tumor -3.200 2.0e-02
Down syndrome -1.500 5.1e-03
ependymoma -5.500 1.1e-03
glioblastoma -3.500 1.1e-05
group 3 medulloblastoma -4.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.600 5.6e-03
medulloblastoma, large-cell -5.400 1.8e-03
oligodendroglioma -3.100 1.2e-02
Pick disease -1.400 3.2e-02
pituitary cancer -1.300 6.0e-03
primitive neuroectodermal tumor -4.900 3.9e-04

Protein-protein Interaction (1)

Gene RIF (91)

AA Sequence

MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQAR      1 - 70
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS                              71 - 115
//

Text Mined References (119)

PMID Year Title