Property Summary

NCBI Gene PubMed Count 205
Grant Count 532
R01 Count 220
Funding $132,924,374.93
PubMed Score 2133.04
PubTator Score 1889.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (72)

Disease Z-score Confidence
Alzheimer's disease 644 6.568 3.3
Dementia 129 5.695 2.8
Liver Cirrhosis 101 4.386 2.2
Cocaine abuse 3 4.318 2.2
Myasthenia Gravis 26 4.213 2.1
Toxic encephalopathy 131 3.931 2.0
Amnestic disorder 37 3.443 1.7
Hepatitis 61 3.367 1.7
Parkinson's disease 364 3.107 1.6
Acquired metabolic disease 267 2.0
Adverse reaction to drug 54
Apnea 3
Apnea, Postanesthetic 1
Atopic dermatitis 944
Bamforth syndrome 2
Butyrylcholinesterase Deficiency, Fluori... 1 
Butyrylcholinesterase deficiency 1
Carcinoma 2,147 1.0
Cardiotoxicity 2
Cardiovascular Diseases 50
Cardiovascular system disease 194 2.0
Cessation of life 2
Cocaine-Related Disorders 88
Cognition Disorders 23
Dementia associated with Parkinson's Dis... 2 
Hydrolethalus syndrome 128
Hyperactive behavior 31
Hypertriglyceridemia 18
Mammary Neoplasms 410
Multiple Sclerosis 498
Muscular dystrophy 48
Muscular fasciculation 1
Neuroblastoma 78
Neurotoxicity Syndromes 26
Obesity 616
Organophosphate poisoning 4
Paralysed 9
Paresis 2
Pick disease 1,893
Postoperative Complications 4
Renal Cell Carcinoma 199
Seizures 95
Sleep Apnea Syndromes 1
Tachycardia 17
Tonic-clonic epilepsy 47
Trismus 1
adult high grade glioma 2,148
astrocytic glioma 2,241
breast carcinoma 1,614
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
fibroadenoma 557
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
progressive supranuclear palsy 674
psoriasis 6,685

Expression

  Differential Expression (29)

Synonym

Accession P06276 A8K7P8
Symbols E1
CHE1
CHE2

Gene

PANTHER Protein Class (2)

PDB

1EHO   1EHQ   1KCJ   1P0I   1P0M   1P0P   1P0Q   1XLU   1XLV   1XLW   2J4C   2PM8   2WID   2WIF   2WIG   2WIJ   2WIK   2WIL   2WSL   2XMB   2XMC   2XMD   2XMG   2XQF   2XQG   2XQI   2XQJ   2XQK   2Y1K   3DJY   3DKK   3O9M   4AQD   4AXB   4B0O   4B0P   4BBZ   4BDS   4TPK   4XII   5K5E  

 OMIM Term (1)

Gene RIF (197)

PMID Text
27468571 Low BChE activity as a predictor of mortality in acute myocardial infarction might be related to its association with poor cardiac function.
26757188 BCHE-K is associated with a reduced risk for Alzheimer disease and Lewy body dementia whereas APOEvarepsilon4 is associated with more rapid cognitive decline.
26497592 rs1803274 polymorphism of the BCHE gene represents a risk factor for in-stent restenosis after percutaneous coronary intervention.
25933219 BChE is a strong predictor for cardiac mortality specifically in younger patients with acute coronary syndrome aged between 45 and 64 years.
25835709 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 There is a significant decrease in serum ChE activity after severe trauma
25447891 analysis of the T920C mutation allele frequency in butyrylcholinesterase gene in an Indian population
25336127 High resolution melting analysis for the butyrylcholinesterase atypical variant genotyping is a simple, rapid, sensitive and low cost method
25264279 This study proves that the p.Ala34Val BChE variant determines the "silent" phenotype (unable to hydrolyze succinylcholine and mivacurium).
25179377 There is a link between systemic inflammatory markers, oxidative stress, the PON192rs662-Q allele and BuChE-non-UU-phenotype and their corresponding enzymatic activity which may be considered as a risk factor for the severity of rheumatoid arthritis.
More...

AA Sequence

MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLR      1 - 70
FKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIW     71 - 140
IYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNI    141 - 210
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC    211 - 280
SRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN    281 - 350
KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV    351 - 420
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEI    421 - 490
LSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEM    491 - 560
TGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL                                561 - 602
//

Text Mined References (232)

PMID Year Title
27468571 2016 Low Serum-Butyrylcholinesterase Activity as a Prognostic Marker of Mortality Associates with Poor Cardiac Function in Acute Myocardial Infarction.
26922910 2016 Unexpected Reaction Pathway for butyrylcholinesterase-catalyzed inactivation of "hunger hormone" ghrelin.
26757188 2016 Association of Butyrylcholinesterase-K Allele and Apolipoprotein E ?4 Allele with Cognitive Decline in Dementia with Lewy Bodies and Alzheimer's Disease.
26497592 2015 The rs1803274 polymorphism of the BCHE gene is associated with an increased risk of coronary in-stent restenosis.
25933219 2015 Butyrylcholinesterase predicts cardiac mortality in young patients with acute coronary syndrome.
25835709 2015 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 2014 Dynamic changes of serum cholinesterase activity after severe trauma.
25448037 2015 Review of human butyrylcholinesterase structure, function, genetic variants, history of use in the clinic, and potential therapeutic uses.
25447891 2015 The allele frequency of T920C mutation in butyrylcholinesterase gene is high in an Indian population.
25336127 [Rapid detection of BCHE atypical variant (p.Asp70Gly) by high resolution melting curve analysis].
More...