Property Summary

NCBI Gene PubMed Count 205
PubMed Score 2133.04
PubTator Score 1889.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
ovarian cancer 8492 4.29601064250653E-30
lung adenocarcinoma 2714 7.4840354780469E-22
malignant mesothelioma 3163 2.25203725068818E-10
pilocytic astrocytoma 3086 9.23598935545207E-10
lung carcinoma 2844 1.37684809021054E-8
non-small cell lung cancer 2798 1.61887330938677E-7
colon cancer 1475 5.518455583345E-7
cystic fibrosis 1670 2.63762173633651E-6
group 4 medulloblastoma 1875 5.27823376543969E-6
lung cancer 4473 1.46983652275819E-5
psoriasis 6685 7.77540234882547E-5
Atopic dermatitis 944 1.34977298089782E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.88816802109765E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.41569559121287E-4
adult high grade glioma 2148 5.10194993294155E-4
posterior fossa group A ependymoma 1511 7.0046443961225E-4
breast carcinoma 1614 7.39305938447755E-4
cutaneous lupus erythematosus 1056 0.00192612352865665
medulloblastoma, large-cell 6234 0.00252782506237021
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00516419644558668
invasive ductal carcinoma 2950 0.00695674037954368
Pick disease 1893 0.00818693596600789
fibroadenoma 557 0.0107327773140301
interstitial cystitis 2299 0.0144982963976175
Hydrolethalus syndrome 128 0.0147704335958
oligodendroglioma 2849 0.0179163252255936
astrocytic glioma 2241 0.0201455364294601
progressive supranuclear palsy 674 0.0368797514308375
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (29)

Synonym

Accession P06276 A8K7P8
Symbols E1
CHE1
CHE2

Gene

PANTHER Protein Class (2)

PDB

1EHO   1EHQ   1KCJ   1P0I   1P0M   1P0P   1P0Q   1XLU   1XLV   1XLW   2J4C   2PM8   2WID   2WIF   2WIG   2WIJ   2WIK   2WIL   2WSL   2XMB   2XMC   2XMD   2XMG   2XQF   2XQG   2XQI   2XQJ   2XQK   2Y1K   3DJY   3DKK   3O9M   4AQD   4AXB   4B0O   4B0P   4BBZ   4BDS   4TPK   4XII   5K5E  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 OMIM Term (1)

 CSPA Cell Line (2)

Gene RIF (197)

PMID Text
27468571 Low BChE activity as a predictor of mortality in acute myocardial infarction might be related to its association with poor cardiac function.
26757188 BCHE-K is associated with a reduced risk for Alzheimer disease and Lewy body dementia whereas APOEvarepsilon4 is associated with more rapid cognitive decline.
26497592 rs1803274 polymorphism of the BCHE gene represents a risk factor for in-stent restenosis after percutaneous coronary intervention.
25933219 BChE is a strong predictor for cardiac mortality specifically in younger patients with acute coronary syndrome aged between 45 and 64 years.
25835709 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 There is a significant decrease in serum ChE activity after severe trauma
25447891 analysis of the T920C mutation allele frequency in butyrylcholinesterase gene in an Indian population
25336127 High resolution melting analysis for the butyrylcholinesterase atypical variant genotyping is a simple, rapid, sensitive and low cost method
25264279 This study proves that the p.Ala34Val BChE variant determines the "silent" phenotype (unable to hydrolyze succinylcholine and mivacurium).
25179377 There is a link between systemic inflammatory markers, oxidative stress, the PON192rs662-Q allele and BuChE-non-UU-phenotype and their corresponding enzymatic activity which may be considered as a risk factor for the severity of rheumatoid arthritis.
More...

AA Sequence

MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLR      1 - 70
FKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIW     71 - 140
IYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNI    141 - 210
AAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGC    211 - 280
SRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVN    281 - 350
KDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV    351 - 420
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEI    421 - 490
LSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEM    491 - 560
TGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL                                561 - 602
//

Text Mined References (232)

PMID Year Title
27468571 2016 Low Serum-Butyrylcholinesterase Activity as a Prognostic Marker of Mortality Associates with Poor Cardiac Function in Acute Myocardial Infarction.
26922910 2016 Unexpected Reaction Pathway for butyrylcholinesterase-catalyzed inactivation of "hunger hormone" ghrelin.
26757188 2016 Association of Butyrylcholinesterase-K Allele and Apolipoprotein E ?4 Allele with Cognitive Decline in Dementia with Lewy Bodies and Alzheimer's Disease.
26497592 2015 The rs1803274 polymorphism of the BCHE gene is associated with an increased risk of coronary in-stent restenosis.
25933219 2015 Butyrylcholinesterase predicts cardiac mortality in young patients with acute coronary syndrome.
25835709 2015 Complement component C3 and butyrylcholinesterase activity are associated with neurodegeneration and clinical disability in multiple sclerosis.
25471831 2014 Dynamic changes of serum cholinesterase activity after severe trauma.
25448037 2015 Review of human butyrylcholinesterase structure, function, genetic variants, history of use in the clinic, and potential therapeutic uses.
25447891 2015 The allele frequency of T920C mutation in butyrylcholinesterase gene is high in an Indian population.
25336127 [Rapid detection of BCHE atypical variant (p.Asp70Gly) by high resolution melting curve analysis].
More...