Property Summary

NCBI Gene PubMed Count 428
Grant Count 673
R01 Count 444
Funding $56,688,029.87
PubMed Score 981.03
PubTator Score 672.12

Knowledge Summary

Patent (140,782)

Expression

Synonym

Accession P06241 B5BU57 E1P557 H0UI48 Q16248 Q5R3A6 Q5R3A7 Q8N5D7
Symbols SLK
SYN
p59-FYN

Gene

FYN

PDB

1A0N   1AZG   1AOT   1AOU   1AVZ   1EFN   1FYN   1G83   1M27   1NYF   1NYG   1SHF   1ZBJ   2DQ7   2MQI   2MRJ   2MRK   3H0F   3H0H   3H0I   3UA6   3UA7   4D8D   4EIK   4U17   4U1P   4ZNX  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (167)

PMID Text
26786295 Data suggest both KLF5 (Kruppel like factor 5) and FYN are important in regulation of migration in bladder cancer cells; KLF5 up-regulates cell migration, lamellipodia formation, FYN expression, and phosphorylation of FAK (focal adhesion kinase).
26646899 Results show that three CpG loci within FYN were hypermethylated in obese individuals, while obesity was associated with lower methylation of CpG loci within PIWIL4 and TAOK3.
26624980 Neuroendocrine differentiation in prostate cancer cells and visceral metastasis, are least in part, regulated by FYN kinase.
26561212 In this study, it is shown that the alternatively spliced FynT isoform is specifically up-regulated in the AD neocortex, with no change in FynB isoform.
26407913 our results provide no evidence that the Fyn -93A>G SNP contributes to the susceptibility to acute liver transplant rejection in a Caucasian population.
26384592 Data provide structural insight into the dimerization of Fyn SH2 both in solution and in crystalline conditions, providing novel crystal structures of both the dimer and peptide-bound structures of Fyn SH2.
26382759 Results show that Fyn differentially modulates Nav1.5 channel splice variants. It phosphorylates Nav1.5 variants Q-del and Q-pre resulting in there hyperpolarizing and depolarizing shift. Fyn's activity is abolished in the presence of both variants.
26365631 Fyn facilitates mitotic spindle formation through the increase in microtubule polymerization, resulting in the acceleration of M-phase progression.
26125726 Our results establish that Fyn can arrest SW-induced apoptosis via the activity of Akt and its effective phosphorylation in 293T cells.
26001218 Mutation of Fyn phosphorylation sites on PIKE-A, depletion of Fyn, or pharmacological inhibition of Fyn blunts the association between PIKE-A and AMPK, resulting in loss of its inhibitory effect on AMPK.
More...

AA Sequence

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSS      1 - 70
SHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAP     71 - 140
VDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDN    141 - 210
GGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNG    211 - 280
QFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSL    281 - 350
LDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY    351 - 420
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD    421 - 490
CPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL                           491 - 537
//

Text Mined References (450)

PMID Year Title
27001024 2016 Novel autophosphorylation sites of Src family kinases regulate kinase activity and SH2 domain-binding capacity.
26786295 2016 KLF5 promotes cell migration by up-regulating FYN in bladder cancer cells.
26646899 2015 Genome-wide methylation analysis identifies differentially methylated CpG loci associated with severe obesity in childhood.
26624980 2015 SRC family kinase FYN promotes the neuroendocrine phenotype and visceral metastasis in advanced prostate cancer.
26561212 2016 An isoform-specific role of FynT tyrosine kinase in Alzheimer's disease.
26407913 2015 Role of the Fyn -93A>G polymorphism (rs706895) in acute rejection after liver transplantation.
26384592 2015 Structural insights into the intertwined dimer of fyn SH2.
26382759 2015 Differential modulation of fast inactivation in cardiac sodium channel splice variants by Fyn tyrosine kinase.
26365631 2016 Fyn Accelerates M Phase Progression by Promoting the Assembly of Mitotic Spindle Microtubules.
26125726 2015 Fyn arrests swainsonine-induced apoptosis in 293T cells via Akt and its phosphorylation.
More...